DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP003702

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_313494.5 Gene:AgaP_AGAP003702 / 1274378 VectorBaseID:AGAP003702 Length:1532 Species:Anopheles gambiae


Alignment Length:304 Identity:59/304 - (19%)
Similarity:93/304 - (30%) Gaps:139/304 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KRECAE------CSCGNINTRHRIVGGQETE----VHE----------------YPWMIMLMWFG 104
            ::||..      |||.|..|.|.  .|.:.:    .||                ||.....:|  
Mosquito  1195 QQECKNTVGSYVCSCRNGYTLHD--NGHDCKESGCKHEIFTPHGQILSPNYPDYYPPKKDCIW-- 1255

  Fly   105 NFYCGASLVNDQYALTAAHCV----NGF---------YHRLITVRLLEHNRQDSHVKIVDRRVSR 156
                       .:..|..|.:    |.|         |..::   :.:.|..|||.  :.|....
Mosquito  1256 -----------HFTTTPGHRIRLVFNVFDIEPHQECAYDHIV---IYDGNSPDSHT--LGRFCGA 1304

  Fly   157 VLIHPKYSTRN-----FDSDIALIR-----------------------FNEPVRLGIDMHPVCMP 193
            .:.||..|:.|     |::|.::.|                       |...::.|..|:     
Mosquito  1305 KIPHPISSSSNQMYMVFNTDTSVQRKGFFASHSTACGGRLKATEVKNHFYSHIKFGSGMY----- 1364

  Fly   194 TPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICA-GYVE- 256
               :|           ||..|...::|:.|.|::..||.|           :.:..:|: .||| 
Mosquito  1365 ---DN-----------GADCEWTIVADSGQNVQLKFLSFE-----------LEEEKMCSYDYVEV 1404

  Fly   257 QGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGV 300
            .||.|    |..||:|                |:.|...|.|.:
Mosquito  1405 YGGLD----DESGPLH----------------GKYCGNANPPEI 1428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 51/282 (18%)
Tryp_SPc 83..314 CDD:238113 51/281 (18%)
AgaP_AGAP003702XP_313494.5 PHA03420 <488..>565 CDD:177648
ZnMc_BMP1_TLD 589..790 CDD:239808
Astacin 596..789 CDD:279708
CUB 792..905 CDD:278839
CUB 909..1019 CDD:278839
FXa_inhibition 1026..1061 CDD:291342
CUB 1065..1180 CDD:278839
FXa_inhibition 1187..1222 CDD:291342 9/28 (32%)
CUB 1227..1336 CDD:278839 22/126 (17%)
CUB 1340..1456 CDD:238001 28/139 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.