DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP003248

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_312959.4 Gene:AgaP_AGAP003248 / 1273921 VectorBaseID:AGAP003248 Length:296 Species:Anopheles gambiae


Alignment Length:298 Identity:88/298 - (29%)
Similarity:140/298 - (46%) Gaps:40/298 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FLDWIQSILGPEVPAEWSSPAKREC--AECSCGNINTRHRIVGGQETEVHEYPWMIML-MWFGN- 105
            |..|:.|.:|....:.:.:||::..  ....||| :...|::.....::.|.|||.:: .|..| 
Mosquito     9 FTLWVASWMGLMCLSAYCTPAQKSLLPQPPMCGN-DAPERLITSLVAQLDEAPWMALIEYWKPNG 72

  Fly   106 ---FYCGASLVNDQYALTAAHCVNGF-----YHR-------LITVRLLEHNR-QDSHVKIVDRRV 154
               :.||.||:|::|.:||||||...     .||       |.|....:|:| .|:.   :|..|
Mosquito    73 SLSYLCGGSLINERYVVTAAHCVTSLPQGWTVHRIRLGEWDLSTSEDCDHSRCNDAP---IDVAV 134

  Fly   155 SRVLIHPKYS--TRNFDSDIALIRFNEPVRLGIDMHPVCMPT--PSENYAGQTAVVTGWGALSEG 215
            .::.:|..|.  :||..:||||||.:..:.....:.|:|:|.  |.:....:|....||  :.|.
Mosquito   135 DKITVHEDYKSPSRNHRNDIALIRLDRQMHYTETVAPICLPQNGPLQTQRYRTMHSVGW--IEEN 197

  Fly   216 -GPISDTLQEVEVPILSQEECRNSNYGESKI--TDNMICAGYVEQGGKDSCQGDSGGPMHVLGSG 277
             |||.....:||..::..:.| :|||.::.|  .|..:|.  .:|  ||:....:|||:....:|
Mosquito   198 FGPIGGKKLQVEQDLVDFQNC-SSNYLQASIALADTQLCV--AQQ--KDNRIDIAGGPLMQRIAG 257

  Fly   278 DAYQLAGIVSW-GEGCAKPNAPGVYTRVGSFNDWIAEN 314
            ..| |.|:.|: |........|.|||.|..:.|||..|
Mosquito   258 HWY-LFGVASFGGRNYGTVELPNVYTNVMEYVDWIESN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 76/254 (30%)
Tryp_SPc 83..314 CDD:238113 77/256 (30%)
AgaP_AGAP003248XP_312959.4 Tryp_SPc 53..291 CDD:214473 75/248 (30%)
Tryp_SPc 54..294 CDD:238113 77/250 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.