DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CLIPB2

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_312956.3 Gene:CLIPB2 / 1273920 VectorBaseID:AGAP003246 Length:355 Species:Anopheles gambiae


Alignment Length:301 Identity:96/301 - (31%)
Similarity:138/301 - (45%) Gaps:51/301 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QLRQSSFLDWIQSILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWF 103
            |.|.|||                  |...||      .|....||:|||.||:.|:||..::.:.
Mosquito    83 QTRTSSF------------------PTSPEC------GIQVTDRIIGGQTTELEEFPWTALIEYR 123

  Fly   104 --GN---FYCGASLVNDQYALTAAHCVNGFYH--RLITVRLLEHNRQDSH--------VKIVDRR 153
              ||   |:||.:|:|.:|.|||||||.....  :|..|||.|.:...::        ...:|..
Mosquito   124 KPGNQYDFHCGGALINARYILTAAHCVQSLPRGWQLNGVRLGEWDLSTANDCSDGICSAGPIDLE 188

  Fly   154 VSRVLIHPKYSTRN--FDSDIALIRFNEPVRLGIDMHPVCMPTP----SENYAGQTAVVTGWGAL 212
            :...:.|..|...:  ..:||||||..:.|.....:.|:|:|..    |.|..|..:...|||. 
Mosquito   189 IESFVAHAGYDAADTAHTNDIALIRLRQDVASSEMIRPICLPLTEPQRSRNRVGTVSFAAGWGK- 252

  Fly   213 SEGGPISDTLQEVEVPILSQEECRNSNYG-ESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGS 276
            :|....|:...:||:.:.....||....| ...:..:.:|||.::  |||:|.||||||:....:
Mosquito   253 TESASASERKLKVELTVQDPSRCRQIYRGINIALKASQMCAGGLQ--GKDTCTGDSGGPLMAKSA 315

  Fly   277 GDAYQLAGIVSWG-EGCAKPNAPGVYTRVGSFNDWIAENTR 316
            | |:.|.|:||:| ..|.....|||||.|..:.|||..|.:
Mosquito   316 G-AWYLIGVVSFGLSKCGTAGYPGVYTNVVEYLDWIESNVQ 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 84/251 (33%)
Tryp_SPc 83..314 CDD:238113 85/253 (34%)
CLIPB2XP_312956.3 CLIP 26..78 CDD:288855
Tryp_SPc 102..350 CDD:214473 84/251 (33%)
Tryp_SPc 103..353 CDD:238113 85/253 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.