DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CLIPD4

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_312102.4 Gene:CLIPD4 / 1273150 VectorBaseID:AGAP002811 Length:385 Species:Anopheles gambiae


Alignment Length:266 Identity:96/266 - (36%)
Similarity:146/266 - (54%) Gaps:31/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNINTRH-RIVGGQETEVHEYPWMIMLMW---FG--NFYCGASLVNDQYALTAAHCVNGFYHRL 132
            ||..:..| |:|||....::.:|||.::.:   ||  :|.||.||:.|::.||||||:  ....|
Mosquito   117 CGVSDVEHNRVVGGVPAALNGWPWMALVGYEEAFGDVDFRCGGSLITDRHVLTAAHCI--LSSLL 179

  Fly   133 ITVRL-LEHNRQDSHVKIVDRRVSRVLI--------HPKYSTRNFDSDIALIRFNEPVRLGIDMH 188
            :.::. :::..:.:||.:...:|....|        ||.|.|.:..||:|::...|.|.....:.
Mosquito   180 VWMQHDMDNQTESAHVDVPVYKVRSTSINFVKSYVSHPSYDTFDGHSDVAILFLTETVEFNARIK 244

  Fly   189 PVCMPT----PSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECR------NSNYGES 243
            |:|:||    .|.::.|....:.|||...|.|..:..|||:::|||..|||.      ...|...
Mosquito   245 PICLPTIEPVRSADFTGYNPFIAGWGRTKETGIEAKVLQELQIPILENEECSQLYKKIRKLYSTK 309

  Fly   244 KITDNMICAGYVEQGGKDSCQGDSGGPM---HVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVG 305
            :..|.::|||::| |||||||||||||:   :::.....|...||||:|.|||:...|||||||.
Mosquito   310 QFDDAVLCAGFLE-GGKDSCQGDSGGPLMLPYLVNKKFHYFQIGIVSYGVGCARAELPGVYTRVV 373

  Fly   306 SFNDWI 311
            :|.||:
Mosquito   374 TFVDWL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 92/255 (36%)
Tryp_SPc 83..314 CDD:238113 92/256 (36%)
CLIPD4XP_312102.4 Tryp_SPc 126..378 CDD:214473 91/254 (36%)
Tryp_SPc 127..379 CDD:238113 91/254 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.