DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CLIPA15

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_312096.5 Gene:CLIPA15 / 1273144 VectorBaseID:AGAP002815 Length:867 Species:Anopheles gambiae


Alignment Length:240 Identity:92/240 - (38%)
Similarity:135/240 - (56%) Gaps:13/240 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFY-CGASLVNDQYALTAAHCVNGFYHR--LITVRLLEHN-- 141
            |:|||::.|..|:.|.:.|:...|.| |||:|:..|:.|||||||......  .|.||:.:::  
Mosquito   622 RVVGGEDGENGEWCWQVALINSLNQYLCGAALIGTQWVLTAAHCVTNIVRSGDAIYVRVGDYDLT 686

  Fly   142 RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY-AGQTAV 205
            |:.........||:...||..::::..|:||||::.:....|...:..||:|....:: ||:...
Mosquito   687 RKYGSPGAQTLRVATTYIHHNHNSQTLDNDIALLKLHGQAELRDGVCLVCLPARGVSHAAGKRCT 751

  Fly   206 VTGWGALSEGGPISDTLQEVEVPILSQEEC-RNSNYGESKI---TDNMICAGYVEQGGKDSCQGD 266
            |||:|.:.|.|||...::|.|:||:|..|| |..|....||   ..:..|||..|  |.|:||||
Mosquito   752 VTGYGYMGEAGPIPLRVREAEIPIVSDAECIRKVNAVTEKIFILPASSFCAGGEE--GNDACQGD 814

  Fly   267 SGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            .|||: |......::|||:||||.||.:.:.||||.:|.||..||
Mosquito   815 GGGPL-VCQDDGFFELAGLVSWGFGCGRVDVPGVYVKVSSFIGWI 858

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 90/238 (38%)
Tryp_SPc 83..314 CDD:238113 91/239 (38%)
CLIPA15XP_312096.5 Tryp_SPc 622..858 CDD:214473 90/238 (38%)
Tryp_SPc 623..861 CDD:238113 91/239 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.