DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP010730

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_311444.4 Gene:AgaP_AGAP010730 / 1272531 VectorBaseID:AGAP010730 Length:256 Species:Anopheles gambiae


Alignment Length:262 Identity:72/262 - (27%)
Similarity:116/262 - (44%) Gaps:60/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 EYPWMIMLMWF-------GNFYCGASLVNDQYALTAAHCVNG----------------------- 127
            ||||::.::..       |:|.||.:|::.:..:|.||..:|                       
Mosquito     7 EYPWVVYILALKKQEANSGDFVCGGTLIHSRLVVTTAHNTDGKTDLVARFGEWDISTTKEPFPQQ 71

  Fly   128 --FYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPV 190
              |.|:                   |..|:.|:.||:|......:||||:...|.|:....:.|:
Mosquito    72 CLFPHQ-------------------DIDVAEVIKHPQYVFNPIQNDIALLVLAENVQYAAHIRPI 117

  Fly   191 CMPTPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEEC----RNSNYGE-SKITDNMI 250
            |:|.|::.:.||..|..|||  .|.|..::.::::.:|::.:..|    |.:..|. ..:.:..:
Mosquito   118 CLPQPTDEFVGQRCVSNGWG--KERGVYANVMKKLTLPVIGRANCTRMLRYAGLGPFYTLREGFL 180

  Fly   251 CAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENT 315
            |||  .:...|.|:||.|.|:........|.||||||||.||...|.||||..|..:..|:.|:.
Mosquito   181 CAG--GEVAVDMCKGDGGSPLACQTESGTYVLAGIVSWGIGCGGFNTPGVYVAVNRYVQWLNEHI 243

  Fly   316 RD 317
            .|
Mosquito   244 VD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 69/254 (27%)
Tryp_SPc 83..314 CDD:238113 70/257 (27%)
AgaP_AGAP010730XP_311444.4 Tryp_SPc 7..242 CDD:238113 70/257 (27%)
Tryp_SPc 7..238 CDD:214473 69/253 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.