DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CLIPA9

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_309727.4 Gene:CLIPA9 / 1270989 VectorBaseID:AGAP010968 Length:361 Species:Anopheles gambiae


Alignment Length:287 Identity:73/287 - (25%)
Similarity:122/287 - (42%) Gaps:70/287 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 ECAECSCGNINTRHRIVGGQETEVH----EYPWMIMLMWFG--------NFYCGASLVNDQYALT 120
            :.|:..||:..|...:...:....:    |:||.:.:....        ....|.||::.::.||
Mosquito    88 QTADVQCGSPVTFPLVYNVESNLTYANYGEFPWTVAIFNISFSANEMKLTLVGGGSLIHPKFVLT 152

  Fly   121 AAHCVNGFYHRLITVRLLEHNRQDSHVKIVDRRVSRV----------------------LIHPKY 163
            |||.                      :|..||.|:|.                      :|||.|
Mosquito   153 AAHT----------------------LKKPDRYVARFGEWSINSDAEIYPSQDIGIEEHIIHPSY 195

  Fly   164 -STRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAVVTGWG---ALSEGGPISDTLQE 224
             .:...::||||......|.....:.|:|:|:|::.:.||..:.||||   ...:..||   ::.
Mosquito   196 RDSCLLENDIALAVLKRNVIYTEHIRPICLPSPTDVFDGQRCIATGWGLDVRTQQPAPI---MKR 257

  Fly   225 VEVPILSQEEC----RNSNYGES-KITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAG 284
            :|:|::.::.|    |.:....| |:..:|:|||  .:.|:|:|..|.|.|:.......:|.:||
Mosquito   258 IELPVVPRDRCQLLYRRAEVDYSFKLHRSMMCAG--GEVGEDTCDQDGGTPLACKKEDGSYVVAG 320

  Fly   285 IVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            |.|||..|.:.:|||:|..|..|..||
Mosquito   321 ITSWGLDCGRVDAPGIYVDVAKFACWI 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 67/271 (25%)
Tryp_SPc 83..314 CDD:238113 69/272 (25%)
CLIPA9XP_309727.4 Tryp_SPc 113..350 CDD:238113 69/262 (26%)
Tryp_SPc 113..347 CDD:214473 67/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.