DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP011325

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_309327.4 Gene:AgaP_AGAP011325 / 1270612 VectorBaseID:AGAP011325 Length:631 Species:Anopheles gambiae


Alignment Length:319 Identity:96/319 - (30%)
Similarity:144/319 - (45%) Gaps:60/319 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QSILGPEVPAEWSSP----------AKRECAEC---------------------SCGNINTRHRI 83
            |.|:.|:..:.|:.|          .:..||.|                     .||.. ...:|
Mosquito   322 QFIVYPDGVSRWTIPWLGFVRVGIEDEPRCAVCCQQEADSNNHRKRNLTLLDLEKCGPY-IEEKI 385

  Fly    84 VGGQETEVHEYPWMIMLMWFG-NFYCGASLVNDQYALTAAHCVNGFYHRL--ITVRLLEHNRQDS 145
            ..|.:..:.:||||.:|.... .|.||.:|:|.:|.||||||   |..:|  |:|||.|.:.: |
Mosquito   386 ANGIDAILFQYPWMALLQDTELAFVCGGTLINKRYVLTAAHC---FREKLSKISVRLGEFDLK-S 446

  Fly   146 HVKIVDRR------------VSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMP-TPSE 197
            .:. .|:|            |.|.:.|..||.|:..:||||||.........::.|:|:| :|..
Mosquito   447 DID-CDKRGERCALPPQDIAVERTIKHKDYSARHKVNDIALIRLASEASYNENVMPICLPVSPEM 510

  Fly   198 NYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESK---ITDNMICAGYVEQGG 259
            ....:...|:||| |:|....||.||...:..|..:.|:.....:.|   :..:.:||  :....
Mosquito   511 RTVKEIYYVSGWG-LTENDTSSDVLQVGLLRQLPNDVCQQLLQRKDKYVTVNSDQMCA--IGANR 572

  Fly   260 KDSCQGDSGGPMHVLGSGDAYQLAGIVSWG-EGCAKPNAPGVYTRVGSFNDWIAENTRD 317
            .|:|.||||||:..:.....:...|:||:| ..|.|..||||||||.::.|||.:|..:
Mosquito   573 TDNCSGDSGGPLKTVAVNARFVQYGVVSYGLRTCGKETAPGVYTRVENYIDWILDNLEE 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 83/248 (33%)
Tryp_SPc 83..314 CDD:238113 85/250 (34%)
AgaP_AGAP011325XP_309327.4 Tryp_SPc 44..287 CDD:238113
Tryp_SPc 46..286 CDD:214473
Tryp_SPc 384..625 CDD:214473 83/248 (33%)
Tryp_SPc 385..625 CDD:238113 83/247 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.