DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP005303

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_309096.4 Gene:AgaP_AGAP005303 / 1270372 VectorBaseID:AGAP005303 Length:371 Species:Anopheles gambiae


Alignment Length:310 Identity:77/310 - (24%)
Similarity:134/310 - (43%) Gaps:64/310 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SSFLDWIQSILGPEVPAEWSSPAKRECAEC-------------SCG--NINTRHRIVGGQETEVH 92
            |..|||...:|               |..|             :||  .:.:.:.|..|.:.:..
Mosquito     2 SRSLDWFPLLL---------------CLLCVVVSQTHAQNNHLTCGKRKVKSEYLIQNGIDAKAG 51

  Fly    93 EYPWMIMLMWFGN----FYCGASLVNDQYALTAAHCVNGFYHR---------LITVRLLEHNRQD 144
            .:||.:.:....:    :.||.|::::...|||:|||   |.:         .:.|..:..|...
Mosquito    52 HWPWHVAIFHATSGRMGYACGGSIIDESTILTASHCV---YTKSGVLSVSRVSVDVGRIHLNETS 113

  Fly   145 SHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSEN---YAGQTAVV 206
            ::.:  ...|.::::||::|..:..:|||||:....:.:...:.|||:.|...|   ..|::..:
Mosquito   114 NYTQ--THAVRQIIVHPRFSQHSIINDIALIKLRTNITMSKYVQPVCLWTMDSNQTLIVGRSGTI 176

  Fly   207 TGWGALSEGGPISDTLQEVEVPILSQEECRNSN---YGESKITDNMICAGYVEQGGKDSCQGDSG 268
            .|:| |:|...:||.|::..|.:.....|..|:   :| :.:|.:|.|.  :.|.|..:|.||||
Mosquito   177 VGFG-LNERDVVSDQLKQALVGVQDGLTCIASDRDVFG-THLTTDMFCG--MGQNGASACNGDSG 237

  Fly   269 GPMHVLGSGDAYQLAGIVSWG--EGCAKPNAP---GVYTRVGSFNDWIAE 313
            |.|.....|..| :.|:||:.  ....||..|   ..||.|..:.|||.:
Mosquito   238 GGMFFEVGGKWY-VRGLVSFTPLNANTKPCDPRKNTAYTDVAKYLDWIKQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 66/252 (26%)
Tryp_SPc 83..314 CDD:238113 68/255 (27%)
AgaP_AGAP005303XP_309096.4 Tryp_SPc 44..286 CDD:238113 67/251 (27%)
Tryp_SPc 44..284 CDD:214473 65/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.