DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP006707

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_309036.1 Gene:AgaP_AGAP006707 / 1270350 VectorBaseID:AGAP006707 Length:255 Species:Anopheles gambiae


Alignment Length:240 Identity:71/240 - (29%)
Similarity:117/240 - (48%) Gaps:30/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 HRIVGGQETEVHEYPWMIMLMWFGNFY-CGASLVNDQYALTAAHCVNGFYHRLITVRLL---EHN 141
            :|:|||:..:....|:.:.|...|:.: ||.||:|.::.||||||:.|  |....:::|   ...
Mosquito    29 YRVVGGEVAKNGSAPYQVSLQIPGHGHNCGGSLLNSRWVLTAAHCIVG--HEPTNIQVLVGTNSL 91

  Fly   142 RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRL-----GIDMHPVCMPTPSENYAG 201
            ::...:...|:     |.|..|::..|.:||.|||..|.|:.     .|:.....:|      |.
Mosquito    92 KEGGQLYKPDK-----LFHHNYASPEFRNDIGLIRLKEEVQFSEIVQSIEYSEQVVP------AN 145

  Fly   202 QTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGD 266
            .|..:||||..|.||.:...||.:.|..|:.|:|:..:.....:....:|.  :.:.|:.:|.||
Mosquito   146 VTVRLTGWGRTSAGGSVPTLLQSLNVVTLTNEDCKAKSLYPEHVDVGHLCT--LSRSGEGACNGD 208

  Fly   267 SGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            ||||:...|     :|.|:|::|..|.. ..|..:.||..::|||
Mosquito   209 SGGPLVYEG-----KLVGVVNFGVPCGL-GYPDGFARVSYYHDWI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 69/237 (29%)
Tryp_SPc 83..314 CDD:238113 70/238 (29%)
AgaP_AGAP006707XP_309036.1 Tryp_SPc 30..247 CDD:214473 69/237 (29%)
Tryp_SPc 31..250 CDD:238113 70/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.