DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CTR1_ANOGA

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_309033.2 Gene:CTR1_ANOGA / 1270348 VectorBaseID:AGAP006709 Length:259 Species:Anopheles gambiae


Alignment Length:252 Identity:79/252 - (31%)
Similarity:127/252 - (50%) Gaps:33/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 NTRHRIVGGQETEVHEYPWMIMLM---WFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLE 139
            |..:|:|||:..:....|:.:.|.   |..|  ||.||:||::.||||||:.|.....:.|.:..
Mosquito    28 NYVNRVVGGEVAKNGSAPYQVSLQVPGWGHN--CGGSLLNDRWVLTAAHCLVGHAPGDLMVLVGT 90

  Fly   140 HNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRL-----GIDMHPVCMPTPSENY 199
            ::.::....:   :|.::|.|.:|:...|.:||.|:|..:|||.     .::.....:|      
Mosquito    91 NSLKEGGELL---KVDKLLYHSRYNLPRFHNDIGLVRLEQPVRFSELVQSVEYSEKAVP------ 146

  Fly   200 AGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITD-NMICAGYVEQGGKDSC 263
            |..|..:||||..|..||....||.:.|..||.|:| |...|:...|| ..:|.  :.:.|:.:|
Mosquito   147 ANATVRLTGWGHTSANGPSPTLLQSLNVVTLSNEDC-NKKGGDPGYTDVGHLCT--LTKTGEGAC 208

  Fly   264 QGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI----AENTR 316
            .||||||:...|     :|.|:|::|..||. ..|..:.||..::||:    |.|::
Mosquito   209 NGDSGGPLVYEG-----KLVGVVNFGVPCAL-GYPDGFARVSYYHDWVRTTMANNSK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 75/237 (32%)
Tryp_SPc 83..314 CDD:238113 76/243 (31%)
CTR1_ANOGAXP_309033.2 Tryp_SPc 32..250 CDD:214473 75/237 (32%)
Tryp_SPc 33..253 CDD:238113 75/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.