DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CLIPA10

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_308802.3 Gene:CLIPA10 / 1270130 VectorBaseID:AGAP006954 Length:1130 Species:Anopheles gambiae


Alignment Length:275 Identity:97/275 - (35%)
Similarity:148/275 - (53%) Gaps:31/275 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 WSSPAKRECAECSCGN---INTRHR---IVGGQETEVHEYPWMIMLM----WFGNFYCGASLVND 115
            :.:||.:...:|...|   ||.|.:   .|.| ::|..||||.:.::    ....:.||.:|:::
Mosquito   856 YRNPASQNLGKCGVRNAQGINGRIKNPVYVDG-DSEFGEYPWQVAILKKDPKESVYVCGGTLIDN 919

  Fly   116 QYALTAAHCV---NGFYHRLITVRLLEH--NRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALI 175
            .|.:||||||   |||..|   |||.|.  |........::|.:..|.:||:|.....|:|:|::
Mosquito   920 LYIITAAHCVKTYNGFDLR---VRLGEWDVNHDVEFYPYIERDIISVQVHPEYYAGTLDNDLAIL 981

  Fly   176 RFNEPVRLGIDMH--PVCMPTPSENYAGQTAVVTGWG--ALSEGGPISDTLQEVEVPILSQEECR 236
            :.:.||.|....|  |.|:|....:::||....||||  |..:.|...:.|:||:|||::..:|:
Mosquito   982 KMDRPVDLTSAPHIAPACLPDKHTDFSGQRCWTTGWGKDAFGDYGKYQNILKEVDVPIVNHYQCQ 1046

  Fly   237 N----SNYGES-KITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPN 296
            |    :..|.: .:....||||..|  |||:|:||.|||: |......:|:.|:||||.||.:.|
Mosquito  1047 NQLRQTRLGYTYNLNQGFICAGGEE--GKDACKGDGGGPL-VCERNGVWQVVGVVSWGIGCGQAN 1108

  Fly   297 APGVYTRVGSFNDWI 311
            .||||.:|..:.|||
Mosquito  1109 VPGVYVKVAHYLDWI 1123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 88/249 (35%)
Tryp_SPc 83..314 CDD:238113 90/247 (36%)
CLIPA10XP_308802.3 Tryp_SPc 888..1126 CDD:238113 88/242 (36%)
Tryp_SPc 888..1123 CDD:214473 86/240 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.