DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP007043

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_001237132.2 Gene:AgaP_AGAP007043 / 1270058 VectorBaseID:AGAP007043 Length:575 Species:Anopheles gambiae


Alignment Length:307 Identity:72/307 - (23%)
Similarity:131/307 - (42%) Gaps:61/307 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LGPEVPAEWSSPAKR--------------ECAECSCG--NINTRHRIVGGQETEVHEYPWMIMLM 101
            :|..:...|..|.:.              |.|..:||  .::....:..|...|..::||.:.| 
Mosquito     1 MGKVISECWGIPTQAVMALLVLLLIQQPFEVAASTCGVRRLSPMGLVTKGIIAEPGDWPWHVAL- 64

  Fly   102 WFGN-------FYCGASLVNDQYALTAAHCV---NGFYHRLITVRLLEHNRQDSHVKIVDRRVSR 156
             |.:       :.||.|:::..:.|:||||:   |..::.|...  :.|...|:...:|...:..
Mosquito    65 -FAHMKSEKPAYKCGGSIISQHFVLSAAHCIKEPNPDHYFLKAG--IHHLNNDNDTSVVVYNLFE 126

  Fly   157 VLIHPKYSTRNFDSDIALIRFNEPVRL-GIDMHPVCM-PTPSE---NYAGQTAVVTGWGALSEGG 216
            :::||||....|.:||||:|.:..:.. ...:.|:|: ||.:.   :...::.:..|:| ..|..
Mosquito   127 IILHPKYDRHTFYNDIALMRPDRAISFASFSIFPICLWPTHNATLIDVLSRSGIAVGFG-FDETH 190

  Fly   217 PISDTLQEVEVPILSQEECRNSNYGESKITDNM---------ICAGYVEQGGKDSCQGDSGGPMH 272
            .||:|||:..:.::.:::|      ..::.:::         :||...|.|. :.|.|||||.::
Mosquito   191 RISETLQQASMKVIEKQQC------IEQLPEHVRFLPQDAGKMCAIGTESGA-NVCSGDSGGGLY 248

  Fly   273 VLGSGDAYQLAGIVS--------WGEGCAKPNAPGVYTRVGSFNDWI 311
             ......:.|.||||        .||.......|..||.|..:..||
Mosquito   249 -FAKDQVWYLRGIVSAAARRDLDTGEATCNAALPATYTDVAQYTTWI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 63/260 (24%)
Tryp_SPc 83..314 CDD:238113 65/261 (25%)
AgaP_AGAP007043XP_001237132.2 Tryp_SPc 50..297 CDD:238113 65/258 (25%)
Tryp_SPc 50..294 CDD:214473 63/256 (25%)
Tryp_SPc 330..573 CDD:304450
Tryp_SPc 330..570 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.