DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CMA1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001827.1 Gene:CMA1 / 1215 HGNCID:2097 Length:247 Species:Homo sapiens


Alignment Length:253 Identity:81/253 - (32%)
Similarity:120/253 - (47%) Gaps:36/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 CAECSCGNINTRHRIVGGQETEVHEYPWM----IMLMWFGNFYCGASLVNDQYALTAAHCVNGFY 129
            |:....|      .|:||.|.:.|..|:|    |:.....:.:||..|:...:.||||||..   
Human    14 CSRAEAG------EIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAG--- 69

  Fly   130 HRLITVRLLEHN---RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVC 191
             |.|||.|..||   .:|:..|:   .|.:...||||:|.....||.|::..|...|.:.:.  .
Human    70 -RSITVTLGAHNITEEEDTWQKL---EVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVG--T 128

  Fly   192 MPTPSE-NYA--GQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAG 253
            :|.||: |:.  |:...|.|||......|.|||||||::.::..:.|.:....:..:   .:|.|
Human   129 LPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNL---QLCVG 190

  Fly   254 YVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            ...: .|.:.:||||||:...|...     ||||:|...|||  |.|:||:..:..||
Human   191 NPRK-TKSAFKGDSGGPLLCAGVAQ-----GIVSYGRSDAKP--PAVFTRISHYRPWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 77/238 (32%)
Tryp_SPc 83..314 CDD:238113 79/239 (33%)
CMA1NP_001827.1 Tryp_SPc 22..243 CDD:238113 79/239 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.