DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Gzmbl3

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001316809.1 Gene:Gzmbl3 / 120766154 RGDID:2320502 Length:248 Species:Rattus norvegicus


Alignment Length:248 Identity:75/248 - (30%)
Similarity:118/248 - (47%) Gaps:36/248 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IVGGQETEVHEYPWMIMLMWF----GNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHN-- 141
            |:||.|.:.|..|:|..|...    |:..||..|:.:.:.||||||:..    .|||.|..||  
  Rat    21 IIGGHEAKPHSRPYMAYLQIMDEDSGSTMCGGFLIQEDFVLTAAHCLGS----KITVTLGAHNIK 81

  Fly   142 RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY---AGQT 203
            .|:...:::.  |.:::.||.|:::.:.:||.|::.....:....:..:.:  |..|:   .|..
  Rat    82 EQEKMQQVIP--VVKIIPHPAYNSKKYSNDIMLLKLKSKAKRTRAVKTLSL--PRSNFKVKPGDV 142

  Fly   204 AVVTGWGALSEGGPISDTLQEVEVPILSQEECR---NSNYGESKITDNMICAG--YVEQGGKDSC 263
            ..|.|||.|...|...|.|||||:.:...:||.   ...|.::    |.||||  .:::.   |.
  Rat   143 CNVAGWGKLGPMGKFPDKLQEVELTVQEDQECETYFKKAYNKA----NQICAGDPKIKRA---SF 200

  Fly   264 QGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTR 316
            .||||||:..     ....||||::|.  ...:||..:|:|.:|..||.|..:
  Rat   201 GGDSGGPLVC-----KKVAAGIVAYGS--KNGSAPEAFTKVSTFLSWIKETMK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 72/241 (30%)
Tryp_SPc 83..314 CDD:238113 74/244 (30%)
Gzmbl3NP_001316809.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.