DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and LOC116411715

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_031760387.1 Gene:LOC116411715 / 116411715 -ID:- Length:386 Species:Xenopus tropicalis


Alignment Length:321 Identity:107/321 - (33%)
Similarity:150/321 - (46%) Gaps:55/321 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 ECS------CGN---INTRHRIVGGQETEVHEYPWMIMLM-----WFGNFYCGASLVNDQYALTA 121
            ||.      |||   .|...||||||.:...::|||:.:.     .|.:. ||.|::|:.:.|||
 Frog    21 ECESAIGGICGNRPLFNKGSRIVGGQNSPPGKWPWMVSIQSPTGKEFSHL-CGGSVLNEIWVLTA 84

  Fly   122 AHCVNGFYH----------RLI----TVRLLEHNRQDSHVKIVDRRVSRVLIHPK-YSTRNFDSD 171
            |||   |.|          ||:    .:::||     |.|:|  |::..| |.|| |:.....:|
 Frog    85 AHC---FKHLQRKEETKSWRLVFGANNLKVLE-----SSVQI--RKIKEV-IQPKAYNPTTEAND 138

  Fly   172 IALIRFNEPVRLGIDMHPVCMPTPSENYAGQT-AVVTGWGAL-SEGGPISDTLQEVEVPILSQEE 234
            |.|:|.::|:.....:.|.|.||...|...:| ..:.|||.| .|.|..|:.|||..|..:..::
 Frog   139 ITLLRLDKPIVFTDYVQPACFPTEFANVEKKTDCYIAGWGVLDEESGEPSEILQEARVHQIDSKK 203

  Fly   235 CRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGP-MHVLGSGDAYQLAGIVSWGEGCAKPNAP 298
            |.:.::.:..|.:..:|||: |:||.|||||||||| |........|.:.||.|||.|||:...|
 Frog   204 CNSKDWYDGAIGEYNLCAGH-EKGGIDSCQGDSGGPLMCKTQKSRTYAVVGITSWGSGCARGKKP 267

  Fly   299 GVYTRVGSFNDWIAENTRDACSCAQPEAAGEPASPMETTEQGDQENTTANGAAEADPEVEE 359
            ||||....|..|||....          ..|...|....::...:|.........|.|.||
 Frog   268 GVYTSTKYFIKWIASKVE----------TDEKEKPKIRKKRSLLKNIILPNGQLPDAETEE 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 91/251 (36%)
Tryp_SPc 83..314 CDD:238113 93/253 (37%)
LOC116411715XP_031760387.1 Tryp_SPc 41..280 CDD:214473 91/251 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.