DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and LOC116407774

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_031749650.1 Gene:LOC116407774 / 116407774 -ID:- Length:319 Species:Xenopus tropicalis


Alignment Length:268 Identity:98/268 - (36%)
Similarity:147/268 - (54%) Gaps:38/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AECSCGNINTRHRIVGGQETEVHEYPWMIMLM-WFGNFYCGASLVNDQYALTAAHCVN------- 126
            |...||...:..||:|||....:::||.:.|. ..|..:||.||:|:::.::||||:|       
 Frog    19 AATECGIPQSSERIMGGQAAAQNKWPWQVSLRDTNGRHFCGGSLINNKWVVSAAHCINNPSDLSS 83

  Fly   127 -----GFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGID 186
                 |.|      .|.|.|:|:..|.::     |:::||:|...:..:||:|:.....|.|...
 Frog    84 IVVFLGSY------MLSEPNQQEIRVAVM-----RIIVHPRYDKYSSINDISLLELENEVVLTDA 137

  Fly   187 MHPVCMPTPSENY-AGQTAVVTGWGALSEGGPISD--TLQEVEVPILSQEECRNSNY-----GES 243
            :.|||:||.:..: .|.....|||||:..|.|:.:  .||||.:|::..:.|  |.|     .::
 Frog   138 IIPVCLPTAAVTFPTGLKCWATGWGAILPGVPLPNPKILQEVALPMIDSQTC--SQYFSTPSTKA 200

  Fly   244 KITDN-MICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSF 307
            .|:.| ||||||:: ||||:||||||||: |....:.:.|.||||:|..|.||..|||.|.:..|
 Frog   201 AISPNLMICAGYID-GGKDTCQGDSGGPL-VCSENNRWYLGGIVSYGASCGKPYRPGVNTFLPPF 263

  Fly   308 NDWIAENT 315
            ..|| |:|
 Frog   264 IGWI-EST 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 91/250 (36%)
Tryp_SPc 83..314 CDD:238113 92/252 (37%)
LOC116407774XP_031749650.1 Tryp_SPc 32..270 CDD:238113 93/253 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I3837
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.