DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG18735 and Agrn

DIOPT Version :9

Sequence 1:	NP_652645.1	Gene:	CG18735 / 59137	FlyBaseID:	FBgn0042098	Length:	364	Species:	Drosophila melanogaster
Sequence 2:	XP_006538554.1	Gene:	Agrn / 11603	MGIID:	87961	Length:	2057	Species:	Mus musculus

Alignment Length:	127	Identity:	31/127 - (24%)
Similarity:	40/127 - (31%)	Gaps:	47/127 - (37%)

- Green bases have known domain annotations that are detailed below.

  Fly   188 HPVCMPTPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICA 252
            || |.|.|                 ..||.:...| |..|.:.   :|....:|.:       ||
Mouse  1540 HP-CSPNP-----------------CHGGALCQAL-EAGVFLC---QCPPGRFGPT-------CA 1575

  Fly   253 GYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAEN 314
            ........:.|.|.:  |.|||..|           |..||.|     ..|.|||.:.:.||
Mouse  1576 DEKNPCQPNPCHGSA--PCHVLSRG-----------GAKCACP-----LGRSGSFCETVLEN 1619

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG18735	NP_652645.1	Tryp_SPc	82..311	CDD:214473	29/122 (24%)
CG18735	NP_652645.1	Tryp_SPc	83..314	CDD:238113	29/125 (23%)
Agrn	XP_006538554.1	NtA	46..148	CDD:367356
		KAZAL	198..244	CDD:197624
		KAZAL	274..319	CDD:197624
		Kazal_1	351..391	CDD:333798
		KAZAL_FS	423..463	CDD:238052
		KAZAL	491..536	CDD:197624
		KAZAL	556..601	CDD:197624
		KAZAL	621..666	CDD:197624
		KAZAL	706..752	CDD:197624
		EGF_Lam	795..835	CDD:238012
		Laminin_EGF	849..>885	CDD:365839
		KAZAL	924..971	CDD:197624
		SEA	1121..1245	CDD:214554
		EGF	1322..1352	CDD:333761
		Laminin_G_1	1389..1520	CDD:333802
		Laminin_G_1	1657..1792	CDD:333802
		EGF_CA	1814..1846	CDD:238011
		Laminin_G_1	1910..2040	CDD:333802
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910