DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CSMD2

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001268885.1 Gene:CSMD2 / 114784 HGNCID:19290 Length:3631 Species:Homo sapiens


Alignment Length:401 Identity:80/401 - (19%)
Similarity:121/401 - (30%) Gaps:147/401 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QSILGPEVPAEWS-SPAKRECAECSCGNI-----------------------NTRHRIVGGQETE 90
            |.::..:...:|| ..:...|...|||.:                       |:.:.:||.:..|
Human  2631 QRVIRCQANGKWSLGDSTPTCRIISCGELPIPPNGHRIGTLSVYGATAIFSCNSGYTLVGSRVRE 2695

  Fly    91 VHEYPWMIMLMWFGN--------------FY-----------------CGA--SLVN-----DQY 117
            .     |...:|.|:              ||                 ||.  .:||     :.|
Human  2696 C-----MANGLWSGSEVRCLATQTKLHSIFYKLLFDVLSSPSLTKAGHCGTPEPIVNGHINGENY 2755

  Fly   118 ALTAA---HCVNGFYHRLI--TVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRF 177
            :...:   .|..||  |||  :||:.:   ||.|                :|.:.        .|
Human  2756 SYRGSVVYQCNAGF--RLIGMSVRICQ---QDHH----------------WSGKT--------PF 2791

  Fly   178 NEPVRLGIDMHPVCMPTPSENYAGQTAV--VTGWGALSEGGPISDTLQEVE----VPILSQEECR 236
            ..|:..|...:||...|....:.....|  |...|.::||...|..|...:    :|......|.
Human  2792 CVPITCGHPGNPVNGLTQGNQFNLNDVVKFVCNPGYMAEGAARSQCLASGQWSDMLPTCRIINCT 2856

  Fly   237 NSNYGESKI---------------TDNMIC-AGYVEQGGKD-SCQGDS----------------- 267
            :..:.|:.:               |.:..| .|:...|... |||||.                 
Human  2857 DPGHQENSVRQVHASGPHRFSFGTTVSYRCNHGFYLLGTPVLSCQGDGTWDRPRPQCLLVSCGHP 2921

  Fly   268 GGPMHVLGSGDAYQLAGIVSWGEGC-AKPNAPGVYTRV-GSFNDWIAENTRDACSCAQPEAAGEP 330
            |.|.|...|||:|.:..:|.:  .| .|....|..||: |....|  ..:...||.......|:|
Human  2922 GSPPHSQMSGDSYTVGAVVRY--SCIGKRTLVGNSTRMCGLDGHW--TGSLPHCSGTSVGVCGDP 2982

  Fly   331 ASPMETTEQGD 341
            ..|......||
Human  2983 GIPAHGIRLGD 2993

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 64/313 (20%)
Tryp_SPc 83..314 CDD:238113 65/315 (21%)
CSMD2NP_001268885.1 CUB 66..173 CDD:238001
CCP 179..236 CDD:214478
CUB 242..345 CDD:238001
CCP 383..441 CDD:153056
CUB 445..553 CDD:278839
CCP 561..615 CDD:153056
CUB 618..725 CDD:238001
CCP 731..789 CDD:153056
CUB 792..899 CDD:238001
CCP 907..961 CDD:153056
CUB 964..1072 CDD:238001
CCP 1079..1135 CDD:153056
CUB 1138..1245 CDD:238001
CCP 1251..1308 CDD:153056
CUB 1311..1419 CDD:238001
CCP 1425..1482 CDD:153056
CUB 1485..1590 CDD:278839
CCP <1595..>1687 CDD:332582
CUB 1659..1766 CDD:238001
CCP 1775..1833 CDD:153056
CUB 1836..1941 CDD:238001
CCP 1949..2005 CDD:153056
CUB 2008..2115 CDD:238001
Sushi 2121..2176 CDD:306569
CUB 2180..2286 CDD:238001
Sushi 2292..2349 CDD:306569
CUB 2357..2463 CDD:238001
CCP <2486..2642 CDD:332582 1/10 (10%)
CCP 2609..2850 CDD:332582 47/252 (19%)
CCP 2792..3032 CDD:332582 46/206 (22%)
Sushi 3037..3091 CDD:306569
CCP 3091..3330 CDD:332582
CCP 3290..>3389 CDD:332582
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.