Sequence 1: | NP_652645.1 | Gene: | CG18735 / 59137 | FlyBaseID: | FBgn0042098 | Length: | 364 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001268885.1 | Gene: | CSMD2 / 114784 | HGNCID: | 19290 | Length: | 3631 | Species: | Homo sapiens |
Alignment Length: | 401 | Identity: | 80/401 - (19%) |
---|---|---|---|
Similarity: | 121/401 - (30%) | Gaps: | 147/401 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 50 QSILGPEVPAEWS-SPAKRECAECSCGNI-----------------------NTRHRIVGGQETE 90
Fly 91 VHEYPWMIMLMWFGN--------------FY-----------------CGA--SLVN-----DQY 117
Fly 118 ALTAA---HCVNGFYHRLI--TVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRF 177
Fly 178 NEPVRLGIDMHPVCMPTPSENYAGQTAV--VTGWGALSEGGPISDTLQEVE----VPILSQEECR 236
Fly 237 NSNYGESKI---------------TDNMIC-AGYVEQGGKD-SCQGDS----------------- 267
Fly 268 GGPMHVLGSGDAYQLAGIVSWGEGC-AKPNAPGVYTRV-GSFNDWIAENTRDACSCAQPEAAGEP 330
Fly 331 ASPMETTEQGD 341 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18735 | NP_652645.1 | Tryp_SPc | 82..311 | CDD:214473 | 64/313 (20%) |
Tryp_SPc | 83..314 | CDD:238113 | 65/315 (21%) | ||
CSMD2 | NP_001268885.1 | CUB | 66..173 | CDD:238001 | |
CCP | 179..236 | CDD:214478 | |||
CUB | 242..345 | CDD:238001 | |||
CCP | 383..441 | CDD:153056 | |||
CUB | 445..553 | CDD:278839 | |||
CCP | 561..615 | CDD:153056 | |||
CUB | 618..725 | CDD:238001 | |||
CCP | 731..789 | CDD:153056 | |||
CUB | 792..899 | CDD:238001 | |||
CCP | 907..961 | CDD:153056 | |||
CUB | 964..1072 | CDD:238001 | |||
CCP | 1079..1135 | CDD:153056 | |||
CUB | 1138..1245 | CDD:238001 | |||
CCP | 1251..1308 | CDD:153056 | |||
CUB | 1311..1419 | CDD:238001 | |||
CCP | 1425..1482 | CDD:153056 | |||
CUB | 1485..1590 | CDD:278839 | |||
CCP | <1595..>1687 | CDD:332582 | |||
CUB | 1659..1766 | CDD:238001 | |||
CCP | 1775..1833 | CDD:153056 | |||
CUB | 1836..1941 | CDD:238001 | |||
CCP | 1949..2005 | CDD:153056 | |||
CUB | 2008..2115 | CDD:238001 | |||
Sushi | 2121..2176 | CDD:306569 | |||
CUB | 2180..2286 | CDD:238001 | |||
Sushi | 2292..2349 | CDD:306569 | |||
CUB | 2357..2463 | CDD:238001 | |||
CCP | <2486..2642 | CDD:332582 | 1/10 (10%) | ||
CCP | 2609..2850 | CDD:332582 | 47/252 (19%) | ||
CCP | 2792..3032 | CDD:332582 | 46/206 (22%) | ||
Sushi | 3037..3091 | CDD:306569 | |||
CCP | 3091..3330 | CDD:332582 | |||
CCP | 3290..>3389 | CDD:332582 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |