DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Prss29

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:266 Identity:92/266 - (34%)
Similarity:128/266 - (48%) Gaps:58/266 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IVGGQETEVHEYPWMIML--------MWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLE 139
            ||||......::||.:.|        .|..|  ||.|:::.|:.||||||:              
Mouse    31 IVGGHSAPQGKWPWQVSLRIYRYYWAFWVHN--CGGSIIHPQWVLTAAHCI-------------- 79

  Fly   140 HNRQDSHVKIVDRR--------------VSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPV 190
             ..:|:...:...|              ||||:|||.:......||:||::....|:...::.||
Mouse    80 -RERDADPSVFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPV 143

  Fly   191 CMPTPS-ENYAGQTAVVTGWGALS--EGGPISDTLQEVEVPILSQEEC--------RNSNYGESK 244
            .:|:.| |........||||||:|  ...|....||:|:|.|:....|        |:.|.|:..
Mouse   144 KLPSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEMYHNATRHRNRGQKL 208

  Fly   245 ITDNMICAGYVEQGGKDSCQGDSGGPM--HVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSF 307
            |..:|:|||   ..|:|||.||||||:  :|.||   :.|.|:||||.|||..:.||||.||.||
Mouse   209 ILKDMLCAG---NQGQDSCYGDSGGPLVCNVTGS---WTLVGVVSWGYGCALRDFPGVYARVQSF 267

  Fly   308 NDWIAE 313
            ..||.:
Mouse   268 LPWITQ 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 90/262 (34%)
Tryp_SPc 83..314 CDD:238113 92/266 (35%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 92/266 (35%)
Tryp_SPc 31..271 CDD:214473 90/262 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842997
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.