DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Prss28

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:253 Identity:76/253 - (30%)
Similarity:125/253 - (49%) Gaps:32/253 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IVGGQETEVHEYPWMIMLMWFG---NFY---CGASLVNDQYALTAAHCVNG-----FYHRLITVR 136
            |||||.|...::||.:.|..:.   |.:   ||.|:::.|:.||||||:..     ..:|:....
Mouse    31 IVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGSIIHPQWILTAAHCIQSQDADPAVYRVQVGE 95

  Fly   137 LLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY-A 200
            :..:..|:.      ..:||::|||.|:..:...|:||::....:....::.||.:|..|..: :
Mouse    96 VYLYKEQEL------LNISRIIIHPDYNDVSKRFDLALMQLTALLVTSTNVSPVSLPKDSSTFDS 154

  Fly   201 GQTAVVTGWGALSEGGPISD--TLQEVEVPILSQEEC----RNSNYGESK---ITDNMICAGYVE 256
            .....:.|||.|.:..|:..  .|.||::||...:.|    |..:..|.|   |.|:|:|||   
Mouse   155 TDQCWLVGWGNLLQRVPLQPPYQLHEVKIPIQDNKSCKRAYRKKSSDEHKAVAIFDDMLCAG--- 216

  Fly   257 QGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAEN 314
            ..|:..|.||||||: |....:.:...|:||.|..|:. |.|.:::||.|...||.::
Mouse   217 TSGRGPCFGDSGGPL-VCWKSNKWIQVGVVSKGIDCSN-NLPSIFSRVQSSLAWIHQH 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 74/248 (30%)
Tryp_SPc 83..314 CDD:238113 76/251 (30%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 76/251 (30%)
Tryp_SPc 31..269 CDD:214473 74/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843003
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.