DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and f7

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_571894.2 Gene:f7 / 114423 ZFINID:ZDB-GENE-010814-1 Length:433 Species:Danio rerio


Alignment Length:250 Identity:95/250 - (38%)
Similarity:136/250 - (54%) Gaps:22/250 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 INTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHN 141
            ::.|.|||||.|......||.::|.:....:||..:....:.||||||:.....:.:.:...||:
Zfish   190 VDLRSRIVGGSECPKGHCPWQVLLKYGEKGFCGGVIYKPTWILTAAHCLEKLKVKFLRIVAGEHD 254

  Fly   142 RQDSHVKIVDR------RVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMP----TPS 196
            .:      ||.      :|.::..||.|.:...||||||:|...|:...:...|||:|    ...
Zfish   255 LE------VDEGTEQLIQVDQMFTHPAYVSETADSDIALLRLRTPIVYSVYAVPVCLPLREMAER 313

  Fly   197 ENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEEC-RNSNYGESKITDNMICAGYVEQGGK 260
            |.:|.....|:|||..||.||.|..|:.:.||.:..:|| :.||.   .:|.||.||||:| |.:
Zfish   314 ELWAVSKHTVSGWGKRSEDGPTSRLLRRLLVPRIRTQECVQVSNL---TLTSNMFCAGYIE-GRQ 374

  Fly   261 DSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENT 315
            |||:||||||: |....|...|.||||||:|||:|.:.|:||||.::..||.:.|
Zfish   375 DSCKGDSGGPL-VTRYRDTAFLLGIVSWGKGCARPGSYGIYTRVSNYLQWIRQTT 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 91/239 (38%)
Tryp_SPc 83..314 CDD:238113 92/241 (38%)
f7NP_571894.2 GLA 19..82 CDD:214503
EGF_CA 86..121 CDD:238011
FXa_inhibition 131..166 CDD:291342
Tryp_SPc 195..424 CDD:214473 91/239 (38%)
Tryp_SPc 196..427 CDD:238113 92/241 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.