DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP013020

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_003435910.1 Gene:AgaP_AGAP013020 / 11175979 VectorBaseID:AGAP013020 Length:454 Species:Anopheles gambiae


Alignment Length:326 Identity:77/326 - (23%)
Similarity:136/326 - (41%) Gaps:77/326 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRECAECSCGNINTRHRIV 84
            :|.||.|.:|...:  |:.|.:.            |:.|.:...|.|           ...|..:
Mosquito   165 STQSLVSTNDGTNV--NVIQYQP------------PQTPVDCGLPDK-----------GFSHYSI 204

  Fly    85 GGQETEVHEYPWMIMLMWFGN-----FYCGASLVNDQYALTAAHCV---NGFYHRL--ITVRLLE 139
            .|.......:||...:...|:     :.||::::.:::.:||||||   :|....:  :||....
Mosquito   205 NGVHAHKGMFPWAAPIFHTGSSSKPRYICGSTILTERHLVTAAHCVYNSDGIKQNVSDLTVVPGM 269

  Fly   140 HNRQD-SHVKIVDRRVSRVLIHPKYSTRN---FDSDIALIRFNEPVRLGIDMHPVCMPTPSEN-- 198
            ||..: ....:.:|.|.::.:|..|...:   .|:|||::..::|:.....:.|:||.:.|:|  
Mosquito   270 HNIDNFFEADLQERGVKKIFVHNDYFFEHGMLVDADIAVLLLDDPITYNKLVRPICMWSDSDNLE 334

  Fly   199 -YAGQTAVVTGWGALSEGGPISDTLQEVEVP------ILSQEECRNSNY-----GESKITDNMIC 251
             ..|....|:|||...:|        :.::|      ::.::.| |.|.     .:::|    .|
Mosquito   335 KIVGDEGFVSGWGVTEDG--------KAKIPSYVMATVVDRQTC-NRNLDRLFAAKARI----FC 386

  Fly   252 AGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGE------GCAKPNAPGVYTRVGSFNDW 310
            |   :..|...|.||||... |:..|..|.:.||||:|:      .||..... |||.:..|..|
Mosquito   387 A---DGHGSVPCTGDSGSGF-VIKRGPRYYIRGIVSFGQFDPKTLTCATDKYV-VYTDIAPFRYW 446

  Fly   311 I 311
            :
Mosquito   447 L 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 64/262 (24%)
Tryp_SPc 83..314 CDD:238113 65/263 (25%)
AgaP_AGAP013020XP_003435910.1 GD_N 46..146 CDD:292649
Tryp_SPc 204..450 CDD:238113 65/262 (25%)
Tryp_SPc 204..446 CDD:214473 64/259 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.