DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP013221

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_003436543.1 Gene:AgaP_AGAP013221 / 11175927 VectorBaseID:AGAP013221 Length:318 Species:Anopheles gambiae


Alignment Length:310 Identity:89/310 - (28%)
Similarity:146/310 - (47%) Gaps:46/310 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQ 87
            |::...:..:|::|...:        |...|.|:       |...:...||    |....||||:
Mosquito    31 SVQKCDEYRRIISNKRGV--------ISLTLNPK-------PFYYQSYNCS----NVVDLIVGGE 76

  Fly    88 ETEVHEYPWMIMLMWFG-----------NFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHN 141
            ..:..|:|...:|   |           :|.||.||::|::.||||||.:  |...:.|||.|::
Mosquito    77 AAKHGEFPHQALL---GYPREDGSPEPYSFSCGGSLISDRFILTAAHCFS--YGDPVIVRLGEYD 136

  Fly   142 RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPT-PSENYAGQTAV 205
            ........:|..::.::.||||.......|:||:|.||.|.....:.|.|:.| |:.|.:  ..|
Mosquito   137 LTVDSTTQLDFGIAEIIRHPKYRNSRSYHDLALVRLNETVLFSKVIRPACLWTNPTLNVS--RFV 199

  Fly   206 VTGWGALSEGG-PISDTLQEVEVPILSQEEC----RNSNYGESKITDNMICAGYVEQGGKDSCQG 265
            .||:|...||. .:|..|.:|::.:....:|    |::......|.:..:|.|.: .||||:|||
Mosquito   200 ATGFGKQEEGSTDLSTKLMKVQLDLFPSSDCGELFRDNRKFRDGIDEGQLCVGSL-IGGKDTCQG 263

  Fly   266 DSGGPMHVLGSGDA--YQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAE 313
            |||||:..:....:  |.:.|:.|.|..|...|:..:|::|..:.|||.:
Mosquito   264 DSGGPLQTITEPRSCIYNIVGVTSTGAACGVGNSKAIYSKVAHYLDWIEQ 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 77/247 (31%)
Tryp_SPc 83..314 CDD:238113 79/250 (32%)
AgaP_AGAP013221XP_003436543.1 Tryp_SPc 72..314 CDD:238113 79/250 (32%)
Tryp_SPc 72..311 CDD:214473 77/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.