DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP012946

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_003436544.1 Gene:AgaP_AGAP012946 / 11175517 VectorBaseID:AGAP012946 Length:318 Species:Anopheles gambiae


Alignment Length:268 Identity:82/268 - (30%)
Similarity:136/268 - (50%) Gaps:27/268 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 PAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIML--------MWFGNFYCGASLVNDQYALT 120
            |.:.|...|:    |....||||::.:..|:|...:|        .|..:|.||.:|::||:.||
Mosquito    54 PIQFEVYNCT----NVVQLIVGGEQAKYGEFPHHALLGFSKENGNQWDYDFRCGGTLISDQHILT 114

  Fly   121 AAHCVNGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYST-RNFDSDIALIRFNEPVRLG 184
            ||||.  .|...:.||:.|::.:.......|..::.:..||.||. |::| ||||::...|:.|.
Mosquito   115 AAHCF--AYGDPVIVRVGEYDTELETDDEYDSDIASIRRHPNYSNLRSYD-DIALVKLKHPIVLS 176

  Fly   185 IDMHPVCMPTPSENYAGQTAVVTGWGALSE--GGPISDTLQEVEVPILSQEECRNSNYGESK--- 244
            ..:.|.|: ..:|.......:.||:| .:|  |..:|..:.:|.:......:|..:..|:.:   
Mosquito   177 KHIRPACL-WETEERNSTRYIATGFG-YNETYGTTLSTVMMKVNLDEFPVSDCERNFKGDRRFKQ 239

  Fly   245 -ITDNMICAGYVEQGGKDSCQGDSGGPMHVLGS--GDAYQLAGIVSWGEGCAKPNAPGVYTRVGS 306
             :.|..:|.|.:.: |:|:||||||||:.|:.:  ..:|.:.||.|.|..|...||..:||:|..
Mosquito   240 GVRDGQLCVGSIVE-GRDTCQGDSGGPLQVVTNTKSCSYGVVGITSVGGVCGIGNAKAIYTKVSH 303

  Fly   307 FNDWIAEN 314
            :.|||.:|
Mosquito   304 YIDWIEDN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 75/245 (31%)
Tryp_SPc 83..314 CDD:238113 77/247 (31%)
AgaP_AGAP012946XP_003436544.1 Tryp_SPc 69..311 CDD:238113 77/247 (31%)
Tryp_SPc 69..308 CDD:214473 75/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.