DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Cela1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_291090.2 Gene:Cela1 / 109901 MGIID:95314 Length:266 Species:Mus musculus


Alignment Length:269 Identity:86/269 - (31%)
Similarity:136/269 - (50%) Gaps:43/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNI-----NTRHRIVGGQETEVHEYPWMIMLMW-FGNFY---CGASLVNDQYALTAAHCVNGFY 129
            ||:.     .|..|:|||.|...:.:|..|.|.: :|..:   ||.:|:...:.:||||||:.  
Mouse    13 CGHSTEDVPETDARVVGGAEARRNSWPSQISLQYQYGGSWHHTCGGTLIRSNWVMTAAHCVDS-- 75

  Fly   130 HRLITVRLL--EHN--RQDSHVKIVDRRVSRVLIHPKYSTRNFDS--DIALIR------FNEPVR 182
              .:|.|::  |||  :.|...:.|:  |.:::.||.::..|..:  ||||:|      .|..|:
Mouse    76 --PMTYRVVVGEHNLSQNDGTEQYVN--VQKIVSHPYWNKNNVVAGYDIALLRLAKSVTLNNYVQ 136

  Fly   183 LGIDMHPVCMPTPSENYAGQT-AVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKIT 246
            ||:      :|......|..: ..:||||.....|.::.|||:..:|.:|...|.:|:|..|.:.
Mouse   137 LGV------LPREGTILANNSPCYITGWGRTRTNGELAQTLQQAYLPSVSYSICSSSSYWGSSVK 195

  Fly   247 DNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSW--GEGCAKPNAPGVYTRVGSFND 309
            :.|:|||  ..|.:..||||||||:|.:.:|. |.:.|:.|:  ..||.....|.|:|||.::..
Mouse   196 NTMVCAG--GDGVRSGCQGDSGGPLHCMVNGQ-YAVHGVTSFVSSMGCNVARKPTVFTRVSAYIS 257

  Fly   310 W----IAEN 314
            |    ||.|
Mouse   258 WMNNVIASN 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 80/251 (32%)
Tryp_SPc 83..314 CDD:238113 81/253 (32%)
Cela1NP_291090.2 Tryp_SPc 26..258 CDD:214473 79/246 (32%)
Tryp_SPc 27..262 CDD:238113 79/249 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.