DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Ctrl

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_075671.1 Gene:Ctrl / 109660 MGIID:88558 Length:264 Species:Mus musculus


Alignment Length:248 Identity:87/248 - (35%)
Similarity:134/248 - (54%) Gaps:19/248 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CG------NINTRHRIVGGQETEVHEYPWMIMLMWFGNF-YCGASLVNDQYALTAAHC-VNGFYH 130
            ||      .::...|||.|:......:||.:.|.....| :||.||::..:.:||||| |....|
Mouse    19 CGVPAITPALSYNQRIVNGENAVPGSWPWQVSLQDNTGFHFCGGSLISPNWVVTAAHCQVTPGRH 83

  Fly   131 RLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTP 195
            .::   |.|::|..:...:....::|.:.||.::....::|:.|::...|.|....:.|||:.:.
Mouse    84 FVV---LGEYDRSSNAEPVQVLSIARAITHPNWNANTMNNDLTLLKLASPARYTAQVSPVCLAST 145

  Fly   196 SENY-AGQTAVVTGWGALSEGGPISDT-LQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQG 258
            :|.. :|.|.|.||||.:|..|.::.. ||:|.:|:::..:||  .|..::|||.|||||   ..
Mouse   146 NEALPSGLTCVTTGWGRISGVGNVTPARLQQVVLPLVTVNQCR--QYWGARITDAMICAG---GS 205

  Fly   259 GKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            |..|||||||||: |...|:.:.|.||||||.......||.:||||..|:.||
Mouse   206 GASSCQGDSGGPL-VCQKGNTWVLIGIVSWGTKNCNIQAPAMYTRVSKFSTWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 83/232 (36%)
Tryp_SPc 83..314 CDD:238113 84/233 (36%)
CtrlNP_075671.1 Tryp_SPc 33..257 CDD:214473 83/232 (36%)
Tryp_SPc 34..260 CDD:238113 84/233 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.