DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and PRSS21

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:307 Identity:99/307 - (32%)
Similarity:144/307 - (46%) Gaps:64/307 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 PAKRECAECS--CGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHC-- 124
            |..:|.|..|  ||......|||||::.|:..:||...|..:.:..||.||::.::|||||||  
Human    21 PESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFE 85

  Fly   125 --------------------------VNGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKY 163
                                      :..:|.|..                    ||.:.:.|:|
Human    86 TYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYF--------------------VSNIYLSPRY 130

  Fly   164 STRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQT-AVVTGWGALSEGG--PISDTLQEV 225
             ..|...||||::.:.||.....:.|:|:...:..:..:| ..|||||.:.|..  |...|||||
Human   131 -LGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEV 194

  Fly   226 EVPILSQEECRN--SNYGESK-ITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVS 287
            :|.|::...|.:  ..|...| |..:|:|||.. |||||:|.||||||:....:|..||: |:||
Human   195 QVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNA-QGGKDACFGDSGGPLACNKNGLWYQI-GVVS 257

  Fly   288 WGEGCAKPNAPGVYTRVGSFNDWIAENTRDACSCAQPEAAGEPASPM 334
            ||.||.:||.|||||.:....:|| :........:||    :|:.|:
Human   258 WGVGCGRPNRPGVYTNISHHFEWI-QKLMAQSGMSQP----DPSWPL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 87/262 (33%)
Tryp_SPc 83..314 CDD:238113 88/264 (33%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 88/264 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.