DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Prss48

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_017446782.1 Gene:Prss48 / 108350052 RGDID:11436036 Length:308 Species:Rattus norvegicus


Alignment Length:273 Identity:98/273 - (35%)
Similarity:145/273 - (53%) Gaps:25/273 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQ 116
            :||    |...|..|::..:..||......||||||...:..:||.:.|.:.....||.||:::.
  Rat    13 LLG----AYQGSLTKQKKLQSVCGRPVYSGRIVGGQGAALGHWPWQVSLRFDSTHICGGSLISNH 73

  Fly   117 YALTAAHCV-NGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEP 180
            :.:|||||: ..::..|.:|.|...:|..|... .:..|||::|..|:  .|.|.||||::.:..
  Rat    74 WVMTAAHCIKKTWFSFLYSVWLGSIDRDYSSTG-EEYYVSRIVIPSKH--HNTDGDIALLKLSSR 135

  Fly   181 VRLGIDMHPVCMPTPSENYAGQTAV-VTGWGALSEGGPISDTLQEVEVPILSQEECRN--SNYG- 241
            |.....:.|:|:|..|:......:. |||||...| |....||||:||||::.|.|..  :..| 
  Rat   136 VTFTSLVLPICLPNISKPLTVPASCWVTGWGQNQE-GHYPSTLQELEVPIITGEACEQLYNPIGF 199

  Fly   242 -----ESKITDNMICAGYVEQGGKDSCQGDSGGPM--HVLGSGDAYQLAGIVSWGEGCAKPNAPG 299
                 |..|.::|:|||.::| .||||:||||||:  |:.|   .:...|::|||..|.| |.||
  Rat   200 FLPDLERIIKEDMLCAGEIQQ-SKDSCKGDSGGPLSCHIDG---VWTQIGVISWGLECGK-NLPG 259

  Fly   300 VYTRVGSFNDWIA 312
            |||.|..:..||:
  Rat   260 VYTNVTYYQKWIS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 89/240 (37%)
Tryp_SPc 83..314 CDD:238113 90/242 (37%)
Prss48XP_017446782.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.