DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:326 Identity:114/326 - (34%)
Similarity:157/326 - (48%) Gaps:55/326 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VPAEW------SSPAKREC-------------AECSCGNINTRHRIVGGQETEVHEYPWMIMLMW 102
            |...|      ||..|..|             |.|....:|:.:..||||.:....:||...|.|
Zfish   263 VKGRWVFRVDNSSEVKGSCINTNSQALDSPSAAVCGIIPVNSSNGTVGGQNSSAVHWPWQASLYW 327

  Fly   103 FGNFYCGASLVNDQYALTAAHCV----NGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKY 163
            :....||.||:|.::.|:||||.    ||||   :||.|....:.......:.|.|..|:.||.|
Zfish   328 YSGQTCGGSLINKEWVLSAAHCFNGQRNGFY---LTVILGPKTQNKYDPSRISRSVKAVIKHPYY 389

  Fly   164 STRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQT-AVVTGWGALSEGGPISD--TLQEV 225
            :....|:||||:|.:.|:.....:.|||:......:...| :.:|.|..:|:|.|:..  ..|||
Zfish   390 NPNTNDNDIALVRLSFPITFTDSIRPVCLAAEGSVFNSDTESWITTWRNISDGVPLPSPKIFQEV 454

  Fly   226 EVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGE 290
            |||::...:| |..||...|||||||||.::: |||.||||||||| |......:..:||||:|.
Zfish   455 EVPVIGNRQC-NCLYGVGSITDNMICAGLLKE-GKDLCQGDSGGPM-VSNQSSVWVQSGIVSFGS 516

  Fly   291 GCAKPNAPGVYTRVGSFNDWIAENTRDACSCAQPEAAGEPASPMETTEQGDQENTTANGAAEADP 355
            |||:...|||||||..:.:||   |...||        :|...::.|..|            |||
Zfish   517 GCAQSEFPGVYTRVSRYQEWI---TYFTCS--------DPPGFVQFTSTG------------ADP 558

  Fly   356 E 356
            :
Zfish   559 D 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 94/235 (40%)
Tryp_SPc 83..314 CDD:238113 96/237 (41%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035 2/8 (25%)
Tryp_SPc 309..537 CDD:238113 94/233 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587886
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.