powered by:
Protein Alignment CG18735 and tmprss2.4
DIOPT Version :9
Sequence 1: | NP_652645.1 |
Gene: | CG18735 / 59137 |
FlyBaseID: | FBgn0042098 |
Length: | 364 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_031752391.1 |
Gene: | tmprss2.4 / 105946686 |
XenbaseID: | XB-GENE-22065955 |
Length: | 571 |
Species: | Xenopus tropicalis |
Alignment Length: | 75 |
Identity: | 21/75 - (28%) |
Similarity: | 32/75 - (42%) |
Gaps: | 11/75 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 221 TLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQ--GGKD--SCQGDSGGPMHVLGSGD--- 278
|.....||| .:..|.:..|.::.|:.|.||.| ::| .|.| :|...:..|..:..|..
Frog 390 TTSTTSVPI-CKLYCISVFYYDTCISTNQICDG-IQQCLYGDDELNCATTTPSPCQMYCSYTYAC 452
Fly 279 --AYQLAGIV 286
|||:...|
Frog 453 IRAYQICNRV 462
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D380103at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.