DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG42694

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:244 Identity:60/244 - (24%)
Similarity:107/244 - (43%) Gaps:31/244 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 WMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDS-HVKIVDRRVSRVLI 159
            |:..:....:..|..||::.|:.|:||.|::  .|..:.|:|...|...| |.    ..||.|:|
  Fly    46 WLAHISNGTHVLCSGSLISKQFVLSAAQCID--VHGKLFVQLGVSNATKSPHW----YTVSNVVI 104

  Fly   160 HPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY----AGQTAVVTGWGALSEGGPISD 220
             |.:|.:....||.|::.::.|.....::|:|:...:...    ..|....:.|  ||:    :.
  Fly   105 -PSHSGKRLQRDIGLLKLSQSVDYNDFVYPICIALNTNTLDMVKILQNFTTSAW--LSK----NK 162

  Fly   221 TLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMH---VLGSGDAYQ- 281
            ..|.:.:..||::.|:.:..|  .:|...|||..:::  .:||..|||..:.   :.||....: 
  Fly   163 NPQTIVLSQLSRDRCKLNLSG--NVTPKEICAASLQR--NNSCFIDSGSALTQPIIQGSNIVREM 223

  Fly   282 LAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAE-----NTRDACSCAQPE 325
            |.||..:..|.:..:.|.:|..|.....||..     :..|:.:.|.||
  Fly   224 LFGIRGYVNGRSWCSEPAIYIDVAECVGWIETVVQQYDGTDSRAVATPE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 54/223 (24%)
Tryp_SPc 83..314 CDD:238113 56/231 (24%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 56/226 (25%)
Tryp_SPc 46..253 CDD:214473 54/223 (24%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.