DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and LOC101734975

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_004918402.1 Gene:LOC101734975 / 101734975 -ID:- Length:251 Species:Xenopus tropicalis


Alignment Length:239 Identity:91/239 - (38%)
Similarity:133/239 - (55%) Gaps:28/239 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 EYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKI-------V 150
            |.||.:.|...|...||.||:|:|:|::||||..|      .:|:.::.......::       |
 Frog     4 EIPWQLSLRKLGLHICGGSLINNQWAISAAHCFAG------PIRVSDYKVNLGAYQLSVPSGIFV 62

  Fly   151 DRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYA-GQTAVVTGWGALSE 214
            |  |:.|.:||.:.......|||||:...||:....:.|||:||.:..:. |...:|:|||.:::
 Frog    63 D--VAAVYVHPTFKGAGSIGDIALIKLANPVQFTDYIIPVCIPTQNVVFPDGMNCIVSGWGTINQ 125

  Fly   215 --GGPISDTLQEVEVPILSQEECRNSNY--------GESKITDNMICAGYVEQGGKDSCQGDSGG 269
              ..|...|||:|.|||:.:..|....:        .:|.|..:|||||| :.|.:.||||||||
 Frog   126 QVSLPYPKTLQKVRVPIIGRASCDQMYHINNPTLPPYQSIIMWDMICAGY-KAGRRGSCQGDSGG 189

  Fly   270 PMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAE 313
            |:....:| ::.||||||||.|||:||.|||||.|.:::.||.|
 Frog   190 PLVCPWNG-SWLLAGIVSWGFGCAQPNKPGVYTSVPAYSAWIQE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 88/235 (37%)
Tryp_SPc 83..314 CDD:238113 91/239 (38%)
LOC101734975XP_004918402.1 Tryp_SPc 2..232 CDD:238113 90/237 (38%)
Tryp_SPc 2..230 CDD:214473 88/235 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.