DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and tmprss2.15

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_031752206.1 Gene:tmprss2.15 / 101732233 XenbaseID:XB-GENE-22065943 Length:504 Species:Xenopus tropicalis


Alignment Length:258 Identity:90/258 - (34%)
Similarity:130/258 - (50%) Gaps:18/258 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AECSCGN----------INTR--HRIVGGQETEVHEYPWMI-MLMWFGN--FYCGASLVNDQYAL 119
            |.|:.||          ::|:  .|||||....|.::||.: :|...|.  :.||.|::...:.:
 Frog   240 ATCASGNMVSLRCISCGLSTKVDSRIVGGTPASVGDWPWQVELLKLVGTSIYLCGGSIITPHWIV 304

  Fly   120 TAAHCVNGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLG 184
            ||||||.|........::...:............|.|.|:||.||:.....|:||::....:...
 Frog   305 TAAHCVYGSTSTPSAFKVFAGSLTIQSYYSAGYTVERALVHPSYSSYTQIYDVALLKLTAALVFT 369

  Fly   185 IDMHPVCMPTPSENYA-GQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDN 248
            .::.|||:|.....:| ||...::|||..:|||.||..|....|||:|...|..:......|:..
 Frog   370 TNLRPVCLPNVGMPWAEGQPCWISGWGTTAEGGSISKNLMAASVPIISSTTCNQAAVYGGAISST 434

  Fly   249 MICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            |:||||: .||.|:||||||||: |..:...:.|.|..|||.|||:...||||..|..|.:||
 Frog   435 MMCAGYL-SGGTDTCQGDSGGPL-VTKTNSLWWLVGDTSWGYGCARAYKPGVYGNVTVFIEWI 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 83/232 (36%)
Tryp_SPc 83..314 CDD:238113 84/233 (36%)
tmprss2.15XP_031752206.1 LDLa 93..121 CDD:238060
SRCR_2 164..259 CDD:406055 4/18 (22%)
Tryp_SPc 265..498 CDD:238113 84/233 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.