DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and LOC101732100

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_031749505.1 Gene:LOC101732100 / 101732100 -ID:- Length:327 Species:Xenopus tropicalis


Alignment Length:277 Identity:102/277 - (36%)
Similarity:147/277 - (53%) Gaps:24/277 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AECSCG-NINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLI 133
            ||.:|| ::....||||||:.:..:|||..:|...|.:.||.:||:.::.::||||::......:
 Frog    23 AEKACGKSVAISDRIVGGQDAKKGKYPWQALLWCPGVYRCGGTLVSSKWVVSAAHCLSRSNASCL 87

  Fly   134 TVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSEN 198
            .|.|..:....:..:.:...|..:.|||.|:..:..:||.|....:.|.....:.|||:||.|..
 Frog    88 AVILGANKLSGNENEEMAVSVKNIYIHPNYNDTDITNDIGLAELTQAVSFTSYVIPVCLPTASTI 152

  Fly   199 Y-AGQTAVVTGWGALSEGGPIS-DTLQEVEVPILSQEECR---NSNYGESKITDNMICAGYVEQG 258
            : .||:..|||||.......:| :|||||::.|||.|:||   :.|.....|||.||||..: .|
 Frog   153 FNPGQSCWVTGWGVTEFNTSLSPNTLQEVQMRILSAEQCRSYYDPNITGVYITDQMICARDI-LG 216

  Fly   259 GKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRDACSCAQ 323
            ||||||||||||: |...|..:.|.|:||:|.||.....|||||.|.::.|||            
 Frog   217 GKDSCQGDSGGPL-VCSYGGNFYLVGVVSFGIGCGDTAYPGVYTYVPAYRDWI------------ 268

  Fly   324 PEAAGEPASPMETTEQG 340
                |:....:.||..|
 Frog   269 ----GKYVPSVSTTSSG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 92/233 (39%)
Tryp_SPc 83..314 CDD:238113 93/235 (40%)
LOC101732100XP_031749505.1 Tryp_SPc 37..268 CDD:238113 91/232 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I3837
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.