DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and prss56

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_017949880.1 Gene:prss56 / 101731690 XenbaseID:XB-GENE-6051085 Length:665 Species:Xenopus tropicalis


Alignment Length:284 Identity:105/284 - (36%)
Similarity:154/284 - (54%) Gaps:21/284 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 EVPAEWSSPAKRECAECSCG--------NINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASL 112
            |:..::.:.:..:.:..:||        |...:.|||||..|....:||::.:.:.|...||..|
 Frog    40 EMNMDYLNTSPDDGSPVTCGQKFSSISNNTGPKGRIVGGSITSPGSWPWLVNIRFNGELMCGGVL 104

  Fly   113 VNDQYALTAAHCVNGFYHRLI-TVRL----LEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDI 172
            ::|.:.||||||..|..:.:: ||.:    |..|.|....    .:|:|::.|||::.:.||:|:
 Frog   105 LDDMWILTAAHCFTGSVNEVLWTVVVGQYDLTKNAQGEKT----FQVNRIVTHPKFNQKTFDNDL 165

  Fly   173 ALIRFNEPVRLGIDMHPVCM-PTPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECR 236
            ||:.....|.......|||: |.|.:...|....:.|||:|.|.||:||.:.|..||:||||.||
 Frog   166 ALLELTSSVTASQSARPVCLPPVPRDPTPGTNCYIAGWGSLYEDGPLSDVIMEARVPVLSQEACR 230

  Fly   237 NSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGS-GDAYQLAGIVSWGEGCAKPNAPGV 300
             |..|::.:|..|.||||: .||.||||||||||:..... ...|.|.||.|||:||.:...|||
 Frog   231 -STLGKNMLTSTMFCAGYL-NGGIDSCQGDSGGPLTCQDPISKQYVLYGITSWGDGCGERGKPGV 293

  Fly   301 YTRVGSFNDWIAENTRDACSCAQP 324
            ||||.:|.|||:.....:....:|
 Frog   294 YTRVTAFTDWISHQMNKSPPIREP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 98/235 (42%)
Tryp_SPc 83..314 CDD:238113 99/237 (42%)
prss56XP_017949880.1 Tryp_SPc 75..305 CDD:238113 98/235 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 190 1.000 Domainoid score I3199
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48875
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.