DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CELA3A

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_005738.4 Gene:CELA3A / 10136 HGNCID:15944 Length:270 Species:Homo sapiens


Alignment Length:291 Identity:84/291 - (28%)
Similarity:141/291 - (48%) Gaps:41/291 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LAQLRQSSFLDWIQSILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLM 101
            :.:|..|..|..:.|..||  |:..||                 .|:|.|::...:.:||.:.|.
Human     2 MLRLLSSLLLVAVASGYGP--PSSHSS-----------------SRVVHGEDAVPYSWPWQVSLQ 47

  Fly   102 W--FGNFY--CGASLVNDQYALTAAHCVNGFYHRLITVRLL--EHNR--QDSHVKIVDRRVSRVL 158
            :  .|:||  ||.||:...:.:||.||::    |.:|.:::  |:|.  ::...:::......:.
Human    48 YEKSGSFYHTCGGSLIAPDWVVTAGHCIS----RDLTYQVVLGEYNLAVKEGPEQVIPINSEELF 108

  Fly   159 IHPKY--STRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQT-AVVTGWGALSEGGPISD 220
            :||.:  |.....:|||||:.:...:||..:....:|...:....:| ..:||||.|...||:.|
Human   109 VHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPD 173

  Fly   221 TLQEVEVPILSQEECRNSNYGESKITDNMICA-GYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAG 284
            .||:..:|::..:.|...|:..|.:...|:|| ||:..|    |.||||||::.......:|:.|
Human   174 KLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSG----CNGDSGGPLNCPTEDGGWQVHG 234

  Fly   285 IVSW--GEGCAKPNAPGVYTRVGSFNDWIAE 313
            :.|:  ..||.....|.|:|||.:|.|||.|
Human   235 VTSFVSAFGCNFIWKPTVFTRVSAFIDWIEE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 72/242 (30%)
Tryp_SPc 83..314 CDD:238113 74/245 (30%)
CELA3ANP_005738.4 Tryp_SPc 28..263 CDD:214473 72/242 (30%)
Tryp_SPc 29..266 CDD:238113 74/245 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.