DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Prss50

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_017451624.2 Gene:Prss50 / 100910205 RGDID:6499372 Length:424 Species:Rattus norvegicus


Alignment Length:287 Identity:78/287 - (27%)
Similarity:120/287 - (41%) Gaps:59/287 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLL 138
            ||:.......:...|.....:|||:.:...|:..|...|:..|:.|..|||             |
  Rat   143 CGSSQEPDPTLRDPEAMTRRWPWMVSVQTNGSHVCAGILIASQWVLAVAHC-------------L 194

  Fly   139 EHNRQDSHVKI------------VDRRVSRVLIHPKYSTRNFDS------DIALIRFNEPVRLGI 185
            ..||.:..|::            .|..|::|:|:..|.::.:.|      ||.|::....::...
  Rat   195 SQNRVNYTVRVGSPWINQTTETSSDVPVNQVIINSGYQSKRYWSWVGRIHDIGLLKLKWGLKYSK 259

  Fly   186 DMHPVCMPTPSENYA---GQTAVVTGWGALSEGG--PISDTLQEVEVPILSQEECRNSNYGESK- 244
            .:.|||:  |...|.   |....|||||.....|  |...||||.||.||:..||.:..:..|: 
  Rat   260 YVWPVCL--PGLEYVVEDGSLCTVTGWGYPKANGLWPQFQTLQEKEVSILNSRECEHYYHKFSRI 322

  Fly   245 ------ITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTR 303
                  |:..||||  ::...:..|...||.|: |..|...:.|.|::|||.||.|..||.::.:
  Rat   323 HSLVRIISPQMICA--LDNDREKFCYERSGEPL-VCSSDGMWYLVGVMSWGPGCKKSEAPPIFLQ 384

  Fly   304 VGSFNDWIAENTRDACSCAQPEAAGEP 330
            |..:..||.:           ..:|||
  Rat   385 VSHYQLWIWD-----------RLSGEP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 71/258 (28%)
Tryp_SPc 83..314 CDD:238113 73/260 (28%)
Prss50XP_017451624.2 Tryp_SPc 162..392 CDD:238113 70/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.