DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and prss59.2

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001268923.1 Gene:prss59.2 / 100535672 ZFINID:ZDB-GENE-110408-10 Length:242 Species:Danio rerio


Alignment Length:239 Identity:101/239 - (42%)
Similarity:136/239 - (56%) Gaps:20/239 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHN---RQ 143
            :||||.|.:.:..||...|. .|..:||.|||::.:.::||||    |...:.|||.|||   .:
Zfish    20 KIVGGYECQPNSQPWQASLN-SGYHFCGGSLVSEYWVVSAAHC----YKSRLEVRLGEHNIVINE 79

  Fly   144 DSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAVVTG 208
            .:...|...:|.|   :|.|.:...||||.||:.::|..|...:.||.:|.... ..|....|:|
Zfish    80 GTEQFITSEKVIR---NPNYDSWTIDSDIMLIKLSKPATLNKYVQPVALPNGCA-ADGTMCRVSG 140

  Fly   209 WGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHV 273
            ||........|:.||.:|:||||..:|:||..|  .|||.|.||||:| |||||||||||||:..
Zfish   141 WGNTMSSTADSNKLQCLEIPILSDRDCKNSYPG--MITDTMFCAGYLE-GGKDSCQGDSGGPVVC 202

  Fly   274 LGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRD 317
            .|     :|.||||||.|||:.:.||||.:|..|:.|||:..|:
Zfish   203 NG-----ELQGIVSWGYGCAQKDNPGVYGKVCMFSQWIADTMRN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 97/231 (42%)
Tryp_SPc 83..314 CDD:238113 100/233 (43%)
prss59.2NP_001268923.1 Tryp_SPc 20..235 CDD:214473 97/231 (42%)
Tryp_SPc 21..238 CDD:238113 100/233 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.