DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and cela1.2

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001307331.1 Gene:cela1.2 / 100535584 ZFINID:ZDB-GENE-050208-732 Length:269 Species:Danio rerio


Alignment Length:250 Identity:79/250 - (31%)
Similarity:124/250 - (49%) Gaps:24/250 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 NINTRHRIVGGQETEVHEYPWMIMLMW--FGN--FYCGASLVNDQYALTAAHCVNGFYHRLITVR 136
            :|....|:|||:..:.|.:||.|.|.:  .|.  :||..:|:...:.:.|||||...  |..||.
Zfish    23 DIAIEERVVGGEIAKPHSWPWQISLQYSDLGTYYYYCSGTLIRPGWVMVAAHCVEAL--RKWTVA 85

  Fly   137 LLEHN-----RQDSHVKIVDRRVSRVLIHPKYSTRN--FDSDIALIRFNEPVRLGIDMHPVCMPT 194
            |.:|:     ..:.::.     ||.|.|||.::..|  |..||||:|.:....|...:....:|:
Zfish    86 LGDHDIYTHEGPEQYIS-----VSEVFIHPNWNPNNVAFGYDIALLRLSIDATLSSYVQVATLPS 145

  Fly   195 PSENYA-GQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQG 258
            ..|... |.|..:||||....||.:|..|::..:|::..|.|...::..|.:.:.|||||...  
Zfish   146 SGEILPYGHTCYITGWGYTETGGSLSAQLKQAYMPVVDYETCSQKDWWGSSVKETMICAGGTT-- 208

  Fly   259 GKDSCQGDSGGPMHVLGSGDAYQLAGIVSW--GEGCAKPNAPGVYTRVGSFNDWI 311
            ...:|.||||.|::.|.:| .|.:.|:.|:  .|||.....|..:|||.::.:||
Zfish   209 SMSACHGDSGSPLNCLFNG-KYVVHGVTSFVSPEGCNTYKKPTGFTRVSAYINWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 76/242 (31%)
Tryp_SPc 83..314 CDD:238113 76/242 (31%)
cela1.2NP_001307331.1 Tryp_SPc 29..262 CDD:214473 76/242 (31%)
Tryp_SPc 30..265 CDD:238113 76/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.