DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Tpsab1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_112464.4 Gene:Tpsab1 / 100503895 MGIID:96943 Length:273 Species:Mus musculus


Alignment Length:271 Identity:102/271 - (37%)
Similarity:138/271 - (50%) Gaps:60/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GNINTRHRIVGGQETEVHEYPWMIML-----MWFGNFYCGASLVNDQYALTAAHCVNG------- 127
            |...||..||||||...:::||.:.|     .|.  .:||.||::.|:.|||||||..       
Mouse    21 GPAMTREGIVGGQEAHGNKWPWQVSLRANDTYWM--HFCGGSLIHPQWVLTAAHCVGPDVADPNK 83

  Fly   128 ----------FYH-RLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPV 181
                      :|| .|:|                   ||:::.||.:......:||||::...||
Mouse    84 VRVQLRKQYLYYHDHLMT-------------------VSQIITHPDFYIVQDGADIALLKLTNPV 129

  Fly   182 RLGIDMHPVCMPTPSENY-AGQTAVVTGWGALSEGG--PISDTLQEVEVPILSQEECRNSNYGES 243
            .:...:|||.:|..||.: :|....|||||.:..|.  |....|:||:|||:....| :..|.:.
Mouse   130 NISDYVHPVPLPPASETFPSGTLCWVTGWGNIDNGVNLPPPFPLKEVQVPIIENHLC-DLKYHKG 193

  Fly   244 KIT--------DNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGV 300
            .||        |:|:|||   ..|.||||||||||: |....|.:..||:||||||||:||.||:
Mouse   194 LITGDNVHIVRDDMLCAG---NEGHDSCQGDSGGPL-VCKVEDTWLQAGVVSWGEGCAQPNRPGI 254

  Fly   301 YTRVGSFNDWI 311
            ||||..:.|||
Mouse   255 YTRVTYYLDWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 97/262 (37%)
Tryp_SPc 83..314 CDD:238113 99/263 (38%)
Tpsab1NP_112464.4 Tryp_SPc 29..266 CDD:238113 99/263 (38%)
Tryp_SPc 29..265 CDD:214473 97/261 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842973
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.