DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and XB5892359

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_031752073.1 Gene:XB5892359 / 100497443 XenbaseID:XB-GENE-5892360 Length:426 Species:Xenopus tropicalis


Alignment Length:275 Identity:77/275 - (28%)
Similarity:127/275 - (46%) Gaps:42/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 CS--CGN---INTRH---RIVGGQETEVHEYPWMIML-MWFGNFY---CGASLVNDQYALTAAHC 124
            ||  ||.   ..:.|   |::.|...:...:||::.: |...:.|   ||.:::|..:.:|||||
 Frog     4 CSTDCGMRPLARSHHRVRRVIDGANAQPGSWPWIVSIQMPIDSVYRHVCGGTVLNHHWVMTAAHC 68

  Fly   125 VNGFYHRLITVRLLEHNRQDSHVKIV--------------DRRVSRVLIHPKYSTRNFDSDIALI 175
                        ||::..:.|..:||              .|::..::.|..::.:...:|||||
 Frog    69 ------------LLKYQSEQSLARIVFGLFNVSDLGPETQIRKIKEMIRHEHFNKKENKNDIALI 121

  Fly   176 RFNEPVRLGIDMHPVCMPTPSENYAGQT-AVVTGWGALSEGGPI-SDTLQEVEVPILSQEECRNS 238
            ..:.||.....:.|.|:|..|.:..... ..:.|||.:.:...| :|.|||.:..:::...|..|
 Frog   122 YLDRPVAFSDYIQPACLPQQSSDITRMNDCYIAGWGLVDDYFRIRTDVLQEAKTELIANSRCNQS 186

  Fly   239 NYGESKITDNMICAGYVEQGGKDSCQGDSGGP-MHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYT 302
            ::...:|.:..:|||: |.||.|:|.|||||| |........|.:.||.|||..|......||||
 Frog   187 DWYNGRIKEYNLCAGF-EHGGPDTCDGDSGGPLMCKRMKAKTYYIVGIASWGGLCGHSYRNGVYT 250

  Fly   303 RVGSFNDWIAENTRD 317
            ....|.:||.:..::
 Frog   251 ATQYFKEWILDKIKN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 70/249 (28%)
Tryp_SPc 83..314 CDD:238113 71/251 (28%)
XB5892359XP_031752073.1 Tryp_SPc 22..259 CDD:214473 70/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.