DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and ovch2

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_031756362.1 Gene:ovch2 / 100496902 XenbaseID:XB-GENE-955935 Length:1023 Species:Xenopus tropicalis


Alignment Length:320 Identity:90/320 - (28%)
Similarity:156/320 - (48%) Gaps:58/320 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SILGPEVPAEWSSPAKRECAECSCG---NINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASL 112
            |.||.|.|   .|.....|.|...|   ::|...|||||:|::..::||.:.|...|..:||..|
 Frog    32 SCLGEEDP---GSIRGARCGESPLGSARDLNYLSRIVGGRESKKGQHPWTVSLKRNGKHFCGGIL 93

  Fly   113 VNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKI----VDR----------RVSRVLIHPKY 163
            |:.::.|||:||            ||:.|.: |::::    .|:          :|..:..||.:
 Frog    94 VSRRHVLTASHC------------LLDRNVK-SYIRVFFGEYDQTIKEDTEQTFKVIEIFKHPDF 145

  Fly   164 S-TRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY-AGQTAVVTGWGALSEGGPISDTLQEVE 226
            : |:..:.|:|::..:..|....::.|.|||.|.:.: .|...|..|||.|:|.|.:...||||.
 Frog   146 NYTQPMNYDVAVLVLDGAVTFDDNIQPACMPNPDDVFEPGDLCVTLGWGHLTENGILPGVLQEVL 210

  Fly   227 VPILSQEECRN--SNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWG 289
            :|:::...|.:  :....:.::..::|||:.| ||||:||||||||:........:.|.|:.|||
 Frog   211 LPLVNLSICLDVMATLKGAVVSSKIVCAGFPE-GGKDACQGDSGGPLLCQRRHGTWVLHGLTSWG 274

  Fly   290 EGCA------------KPNAPGVYTRVGSFNDWIA--------ENTRDACSCAQPEAAGE 329
            .||.            :..:||::|.:.....|::        :.::::||......:|:
 Frog   275 MGCGRSWKNNMFLPANRKGSPGIFTDIQKLLGWVSFQLNTAVTKESKESCSVQDGVLSGK 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 76/258 (29%)
Tryp_SPc 83..314 CDD:238113 76/268 (28%)
ovch2XP_031756362.1 Tryp_SPc 64..309 CDD:238113 76/258 (29%)
CUB 330..436 CDD:238001 1/5 (20%)
CUB 447..558 CDD:238001
Tryp_SPc 606..832 CDD:238113
CUB 888..1000 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.