DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and LOC100495333

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_031749566.1 Gene:LOC100495333 / 100495333 -ID:- Length:313 Species:Xenopus tropicalis


Alignment Length:293 Identity:109/293 - (37%)
Similarity:147/293 - (50%) Gaps:42/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHC---------- 124
            |...||.....:||||||::|..|:||.:.|...|...||.||::.|:|::||||          
 Frog    23 AYSGCGKPIIPNRIVGGQDSEPGEFPWQLSLRRNGLHICGGSLIDSQWAVSAAHCFAQPFSASEF 87

  Fly   125 -VN-GFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDM 187
             || |.|...:...:|             ..|..:.|||.:.......|||||:...||.....:
 Frog    88 QVNLGAYQLSVPSGIL-------------MNVDSIHIHPTFKGIGNSGDIALIKLASPVTFTDLI 139

  Fly   188 HPVCMPTPSENYA-GQTAVVTGWGALS--EGGPISDTLQEVEVPILSQEECRNSNY--------G 241
            .|||:|||...:. |....|||||.:.  ...|...|||:|:|||:.:..|....:        .
 Frog   140 MPVCIPTPEVVFPNGINCTVTGWGTIRYLVNLPYPRTLQKVQVPIIERTTCDQLYHVDNPSLPAS 204

  Fly   242 ESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGS 306
            :|.|..:|||||| :.||||:||||||||:....:| ::.||||||||.|||.||.|||||.|.:
 Frog   205 QSLIMWDMICAGY-KAGGKDACQGDSGGPLVCPWNG-SWILAGIVSWGFGCAVPNRPGVYTSVPA 267

  Fly   307 FNDWIAEN----TRDACSCAQPEAAGEPASPME 335
            ::.|:.|.    .........|..:|..||.:|
 Frog   268 YSAWLQEYIPGFQLTPAQIPPPNHSGTLASSLE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 99/251 (39%)
Tryp_SPc 83..314 CDD:238113 99/253 (39%)
LOC100495333XP_031749566.1 Tryp_SPc 36..274 CDD:238113 99/252 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.