DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and prss12

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_002934300.3 Gene:prss12 / 100495119 XenbaseID:XB-GENE-984837 Length:851 Species:Xenopus tropicalis


Alignment Length:280 Identity:94/280 - (33%)
Similarity:133/280 - (47%) Gaps:45/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 AKRECAECSCGNINTRH----RIVGGQETEVHEYPWMIMLM-----WFGNFYCGASLVNDQYALT 120
            |.:|.:...||: ..:|    ||:||:.:....:||.:.|.     ..|...|||:|::..:.||
 Frog   586 ANKELSPLVCGS-RLQHRRPKRIIGGKNSVRGGWPWQVALRLKSSHGDGRLLCGATLISSCWVLT 649

  Fly   121 AAHCVN-------------GFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDI 172
            ||||..             |.||.|:.....|           |..:.:::||..|.....|.||
 Frog   650 AAHCFKRYGNNTRSYVIRVGDYHTLVPEEYEE-----------DMTIQQIIIHNDYRPDGNDYDI 703

  Fly   173 ALIRFN----EPVRLGIDMHPVCMPTPSE--NYAGQTAVVTGWGALSEGGPISDTLQEVEVPILS 231
            ||||.:    :.|:|...:.|.|:|...|  ........:||||  ..|...|.|||:..|.:|.
 Frog   704 ALIRLHGTAEQCVQLSTHVLPACLPLRRERPQKTASNCYITGWG--DTGRAYSRTLQQATVTLLP 766

  Fly   232 QEECRNSNYGESKITDNMICAGYVE-QGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKP 295
            :..| ...| .|:.|..|:|||.|: |...||||||||||:....||.::.:.|:.|||.||...
 Frog   767 KRVC-EERY-RSQFTGRMLCAGSVKTQKHVDSCQGDSGGPLVCERSGGSWIVYGVTSWGYGCGVK 829

  Fly   296 NAPGVYTRVGSFNDWIAENT 315
            ::|||||:|.:|..||...|
 Frog   830 DSPGVYTKVSAFIPWIKSVT 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 86/253 (34%)
Tryp_SPc 83..314 CDD:238113 87/255 (34%)
prss12XP_002934300.3 KR 78..140 CDD:412161
SRCR 148..244 CDD:395421
SR 257..356 CDD:214555
SR 363..461 CDD:214555
SR 476..575 CDD:214555
Tryp_SPc 607..848 CDD:238113 87/255 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.