DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and LOC100494613

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_002939741.2 Gene:LOC100494613 / 100494613 -ID:- Length:334 Species:Xenopus tropicalis


Alignment Length:287 Identity:97/287 - (33%)
Similarity:144/287 - (50%) Gaps:37/287 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHC------------VN 126
            ||......||:|||..:..::||.:.....|..:||.:|:::|:.::||||            |.
 Frog    25 CGKPLVSSRIMGGQSAQEGQWPWQVSFRNNGRHFCGGTLISNQWVISAAHCFPSSSSASSITAVL 89

  Fly   127 GFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVC 191
            |.|  :|       ::.|.:.:.:  .|.....:|.|.......||:|::...||.....:.|||
 Frog    90 GAY--MI-------DQPDGNQEAI--AVQSATNNPSYINEGDSGDISLVQLASPVTFTDYILPVC 143

  Fly   192 MPTPSENY-AGQTAVVTGWGALSEGG--PISDTLQEVEVPILSQEECRNSNY------GESKIT- 246
            :|..:..: .|....|||||.::...  |...|||||.||::...:| |:.|      |.|.|: 
 Frog   144 LPADTVTFPTGLQCWVTGWGNIASDTNLPSPKTLQEVAVPLIDANKC-NTLYQTPNSDGTSSISV 207

  Fly   247 -DNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDW 310
             .:|||||:: .|||||||||||||:....||..: |||:||:|:||.:...|||||.:.|:.||
 Frog   208 HSDMICAGFI-NGGKDSCQGDSGGPLVCSTSGQWF-LAGVVSFGDGCGQAYRPGVYTLMPSYTDW 270

  Fly   311 IAENTRDACSCAQPEAAGEPASPMETT 337
            |.....||.|..:......|...:..|
 Frog   271 IVSYASDASSNMKSATFSGPIISLNNT 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 88/251 (35%)
Tryp_SPc 83..314 CDD:238113 89/253 (35%)
LOC100494613XP_002939741.2 Tryp_SPc 34..271 CDD:238113 87/250 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.