DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and prss8l.5 loc108703873

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_002939739.1 Gene:prss8l.5 loc108703873 / 100494289 XenbaseID:XB-GENE-22167980 Length:353 Species:Xenopus tropicalis


Alignment Length:257 Identity:91/257 - (35%)
Similarity:145/257 - (56%) Gaps:21/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVN-----GFY 129
            |...||......||:|||:::...:||.:.:......:||.||:..::.::|:||.|     .||
 Frog    23 AVAQCGTRQVSTRIMGGQDSQQGMWPWQVNIRSNDFSFCGGSLITSKWVISASHCFNRTNPPSFY 87

  Fly   130 HRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPT 194
                ||.|..:....::...:...:.|.::||.|::..:..||.|:..:..|.....:.|||:|:
 Frog    88 ----TVYLGSYQLTGANGNEIPMAIQRFIVHPNYTSPEYGHDITLVELSSDVNFTNYIQPVCLPS 148

  Fly   195 PSENY-AGQTAVVTGWGALSEGGPISD--TLQEVEVPILSQEECRN-----SNYGESK--ITDNM 249
            ...|: .|....|||||.::....:.|  |||:|.||::..::|.:     |..|.|.  |.::|
 Frog   149 AGVNFPTGLQCWVTGWGNIASNVSLRDPNTLQQVAVPLIGNQQCNSILQAPSPLGPSSFAILNDM 213

  Fly   250 ICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            :||||:: |||||||||||||: |..:.:.:.|.|:||:|:||.:||.||||.||.::.|||
 Frog   214 LCAGYID-GGKDSCQGDSGGPL-VCAAANQWYLVGVVSFGDGCGQPNRPGVYVRVTAYLDWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 86/243 (35%)
Tryp_SPc 83..314 CDD:238113 87/244 (36%)
prss8l.5 loc108703873XP_002939739.1 Tryp_SPc 35..273 CDD:214473 86/243 (35%)
Tryp_SPc 36..275 CDD:238113 87/244 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I3837
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.