DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and mst1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_004915630.2 Gene:mst1 / 100494056 XenbaseID:XB-GENE-487985 Length:736 Species:Xenopus tropicalis


Alignment Length:262 Identity:77/262 - (29%)
Similarity:123/262 - (46%) Gaps:47/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SCGNINTRH----RIVGGQETEVHEYPWMIMLM-WFGNFYCGASLVNDQYALTAAHC-------V 125
            |||..|.|.    |||||..   ...||.:.|. ..|..:||.|||.:.:.::...|       :
 Frog   492 SCGKRNDRSSQRTRIVGGMP---GNSPWTVSLRNRQGEHFCGGSLVKENWVISTRQCFSSCDADL 553

  Fly   126 NGFYHRLITVRLLEHNRQDSHVKIVDRR---VSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDM 187
            :|:  :.:...|.::...|.    .||:   :|:::..|.      ||.:.:::...||.|...:
 Frog   554 SGY--QAVMGTLFKNPSPDD----PDRQSVPISKIVCGPS------DSSLVMLKLERPVTLNSRV 606

  Fly   188 HPVCMPTPSENYAGQTAV---VTGWGALSEGGPISDTLQEVEV-PILSQEECRNSNY--GESKIT 246
            ..:|:  |.|.|....|.   :.|||  ..||...|.:.::.: .|:|.:|| |.||  ..:|:.
 Frog   607 ALICL--PPERYIVPEATKCEIAGWG--DTGGTGHDNVLKIAIFHIISNDEC-NKNYRSQRNKVL 666

  Fly   247 DNMICAG--YVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFND 309
            ||.:|..  .|:.|   :|:||.|||:..| :.|.:.|.|::....||.|.|.|.::|||..:.|
 Frog   667 DNEMCTKPVPVDVG---ACEGDYGGPLACL-THDCWVLEGVIVPARGCGKKNQPAIFTRVSVYVD 727

  Fly   310 WI 311
            ||
 Frog   728 WI 729

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 70/247 (28%)
Tryp_SPc 83..314 CDD:238113 71/248 (29%)
mst1XP_004915630.2 PAN_AP_HGF 36..114 CDD:238532
KR 118..198 CDD:214527
KR 201..279 CDD:214527
KR 308..390 CDD:214527
KR 397..474 CDD:412161
Tryp_SPc 506..732 CDD:238113 71/248 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.