DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and tmprss2.2

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_002941330.2 Gene:tmprss2.2 / 100493729 XenbaseID:XB-GENE-22065949 Length:521 Species:Xenopus tropicalis


Alignment Length:253 Identity:94/253 - (37%)
Similarity:133/253 - (52%) Gaps:17/253 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 CAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCV---NGFY- 129
            |..|.....:...|||||.......:.|.:.|.:.....||.|:::.::.:||||||   :||. 
 Frog   268 CISCGVSYNSVASRIVGGTYAAYGNWLWQVGLRYNTGILCGGSIISPKWIVTAAHCVYGTDGFLL 332

  Fly   130 ----HRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPV 190
                .|:....|...:..||...:|:    |::.||.|.|.:.|:||||:..:..:..|.:..||
 Frog   333 SASGWRVFAGTLTLPSYYDSSGYLVE----RIIPHPGYKTSSNDNDIALMELSNGITFGYNTQPV 393

  Fly   191 CMPTPSENY-AGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNY-GESKITDNMICAG 253
            |:|.....: :|....::|||..|:||..|..||...|.::....| |.|| ...:||.:|||||
 Frog   394 CLPNAGMFWSSGTPCWISGWGTTSQGGSASTYLQYAAVQLIDSNVC-NQNYVYNGQITASMICAG 457

  Fly   254 YVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            |: .||.||||||||||: |..:...:.|.|..|||.|||:||.||||..:.||..||
 Frog   458 YL-SGGVDSCQGDSGGPL-VTKTNGTWWLVGDTSWGYGCAQPNKPGVYGNMTSFLGWI 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 90/238 (38%)
Tryp_SPc 83..314 CDD:238113 91/239 (38%)
tmprss2.2XP_002941330.2 LDLa <111..134 CDD:238060
LDLa 145..174 CDD:238060
SRCR_2 179..274 CDD:292133 2/5 (40%)
Tryp_SPc 281..513 CDD:214473 90/238 (38%)
Tryp_SPc 282..513 CDD:238113 89/237 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.