DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and LOC100491119

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_004916446.1 Gene:LOC100491119 / 100491119 -ID:- Length:512 Species:Xenopus tropicalis


Alignment Length:296 Identity:99/296 - (33%)
Similarity:156/296 - (52%) Gaps:11/296 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ATPSLRSASDPEKILNNLAQLRQSSFL-DWIQSILGPEVPAEWSSPAKRECAECSCGNINTRHRI 83
            ::|.|.||..| .:|...|.:.::... :.:::.:.|............:|.:|...:::. .||
 Frog   213 SSPVLLSAMSP-IVLEAFAIVNKTDGTPNNLETFMSPVDICPTQEGVSLQCTDCGQASVDI-PRI 275

  Fly    84 VGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHC--VNGFYHRLITVRLLEHNRQDSH 146
            |||.::.:.::||.:.|.|.|...||.|:::.|:.::||||  :|||   |...|...|....|.
 Frog   276 VGGTDSSLGKWPWQVSLRWDGRHMCGGSIISSQWVMSAAHCFVLNGF---LTVSRWKIHAGSISL 337

  Fly   147 VKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY-AGQTAVVTGWG 210
            ...:...|..:..:..||....|.|:||::...|:.......|||:|...:.: ......:.|||
 Frog   338 STGIAYSVRNIYYNGLYSLETNDYDVALLKTTVPMSFSDTTRPVCLPRAYQQFQVTANCWIIGWG 402

  Fly   211 ALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLG 275
            .:||||.:|..|||.:|.::|.:.|.:|:....:|:..|:||||.: |..||||||||||: |..
 Frog   403 HVSEGGQLSPVLQEAKVQLISSQICNHSSNYAGQISPRMLCAGYPD-GRADSCQGDSGGPL-VCQ 465

  Fly   276 SGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            .|..:...|||||||||.:||.|||||.:....||:
 Frog   466 EGGLWWQVGIVSWGEGCGRPNRPGVYTNLTEVLDWV 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 88/231 (38%)
Tryp_SPc 83..314 CDD:238113 88/232 (38%)
LOC100491119XP_004916446.1 SRCR_2 172..269 CDD:373897 10/56 (18%)
Tryp_SPc 275..501 CDD:238113 87/230 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I3837
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.